Recombinant Human CDK5RAP3 Protein, GST-Tagged
| Cat.No. : | CDK5RAP3-1027H |
| Product Overview : | Human CDK5RAP3 full-length ORF (AAH09957, 1 a.a. - 506 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, May 2013] |
| Molecular Mass : | 81.51 kDa |
| AA Sequence : | MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDK5RAP3 CDK5 regulatory subunit associated protein 3 [ Homo sapiens ] |
| Official Symbol | CDK5RAP3 |
| Synonyms | CDK5RAP3; CDK5 regulatory subunit associated protein 3; CDK5 regulatory subunit-associated protein 3; C53; FLJ13660; HSF 27; IC53; ischemic heart CDK5 activator binding protein C53; LXXLL/leucine zipper containing ARFbinding protein; LZAP; MST016; OK/SW cl.114; ischemic heart CDK5 activator-binding protein C53; LXXLL/leucine-zipper-containing ARFbinding protein; HSF-27; OK/SW-cl.114; |
| Gene ID | 80279 |
| mRNA Refseq | NM_176096 |
| Protein Refseq | NP_788276 |
| MIM | 608202 |
| UniProt ID | Q96JB5 |
| ◆ Recombinant Proteins | ||
| CDK5RAP3-3128HF | Recombinant Full Length Human CDK5RAP3 Protein, GST-tagged | +Inquiry |
| CDK5RAP3-1308R | Recombinant Rat CDK5RAP3 Protein | +Inquiry |
| Cdk5rap3-2090M | Recombinant Mouse Cdk5rap3 Protein, Myc/DDK-tagged | +Inquiry |
| CDK5RAP3-613R | Recombinant Rhesus Macaque CDK5RAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDK5RAP3-966R | Recombinant Rat CDK5RAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDK5RAP3-7623HCL | Recombinant Human CDK5RAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK5RAP3 Products
Required fields are marked with *
My Review for All CDK5RAP3 Products
Required fields are marked with *
