Recombinant Human CDK6 Protein, GST-Tagged
Cat.No. : | CDK6-1028H |
Product Overview : | Human CDK6 full-length ORF (AAH52264, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Expression of this gene is up-regulated in some types of cancer. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2009] |
Molecular Mass : | 61.6 kDa |
AA Sequence : | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDK6 cyclin-dependent kinase 6 [ Homo sapiens ] |
Official Symbol | CDK6 |
Synonyms | CDK6; cyclin-dependent kinase 6; PLSTIRE; cell division protein kinase 6; serine/threonine-protein kinase PLSTIRE; MGC59692; |
Gene ID | 1021 |
mRNA Refseq | NM_001145306 |
Protein Refseq | NP_001138778 |
MIM | 603368 |
UniProt ID | Q00534 |
◆ Recombinant Proteins | ||
CDK6-1028H | Recombinant Human CDK6 Protein, GST-Tagged | +Inquiry |
CDK6-790HFL | Recombinant Full Length Human CDK6 Protein, C-Flag-tagged | +Inquiry |
CDK6-1002H | Recombinant Human Cyclin-Dependent Kinase 6, His-tagged | +Inquiry |
CDK6-788R | Recombinant Rhesus monkey CDK6 Protein, His-tagged | +Inquiry |
CDK6-614R | Recombinant Rhesus Macaque CDK6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK6-7622HCL | Recombinant Human CDK6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK6 Products
Required fields are marked with *
My Review for All CDK6 Products
Required fields are marked with *