Recombinant Human CDK7 protein, His-tagged
| Cat.No. : | CDK7-2923H |
| Product Overview : | Recombinant Human CDK7 protein(183-345 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 183-345 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CDK7 cyclin-dependent kinase 7 [ Homo sapiens ] |
| Official Symbol | CDK7 |
| Synonyms | CDK7; cyclin-dependent kinase 7; cyclin dependent kinase 7 (homolog of Xenopus MO15 cdk activating kinase) , cyclin dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk activating kinase); CAK; CAK1; CDKN7; MO15; STK1; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kinase 1; serine/threonine protein kinase MO15; homolog of Xenopus MO15 Cdk-activating kinase; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase); HCAK; p39MO15; |
| Gene ID | 1022 |
| mRNA Refseq | NM_001799 |
| Protein Refseq | NP_001790 |
| MIM | 601955 |
| UniProt ID | P50613 |
| ◆ Recombinant Proteins | ||
| CDK7-2647H | Recombinant Human CDK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDK7-1035H | Active Recombinant Human CDK7 Protein, GST-His-Tagged | +Inquiry |
| Cdk7-1925M | Recombinant Mouse Cdk7 protein, His-tagged | +Inquiry |
| Cdk7-868M | Recombinant Mouse Cdk7 Protein, MYC/DDK-tagged | +Inquiry |
| CDK7-3786H | Recombinant Human CDK7 protein(1-346aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDK7-7621HCL | Recombinant Human CDK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK7 Products
Required fields are marked with *
My Review for All CDK7 Products
Required fields are marked with *
