Recombinant Human CDK8, GST-tagged
| Cat.No. : | CDK8-11H | 
| Product Overview : | Recombinant Human CDK8(1 a.a. - 464 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery. | 
| Molecular Mass : | 79.7 kDa | 
| AA Sequence : | MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKH PNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHR DLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFA ELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQ QQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSAT SQQPPQYSHQTHRY | 
| Applications : | ELISA; WB-Re; AP; Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CDK8 cyclin-dependent kinase 8 [ Homo sapiens (human) ] | 
| Official Symbol | CDK8 | 
| Synonyms | cyclin-dependent kinase 8; K35; MGC126074; MGC126075; protein kinase K35; CDK8 protein kinase; cell division protein kinase 8; EC 2.7.11.22,EC 2.7.11.23; Protein kinase K35; CDK8; OTTHUMP00000018158; Mediator complex subunit CDK8; Mediator of RNA polymerase II transcription subunit CDK8 | 
| Gene ID | 1024 | 
| mRNA Refseq | NM_001260 | 
| Protein Refseq | NP_001251 | 
| MIM | 603184 | 
| UniProt ID | P49336 | 
| Chromosome Location | 13q12 | 
| Pathway | Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants; Developmental Biology; Fatty acid, triacylglycerol, and ketone body metabolism | 
| Function | ATP binding; RNA polymerase II carboxy-terminal domain kinase activity; cyclin-dependent protein serine/threonine kinase activity; protein binding | 
| ◆ Recombinant Proteins | ||
| CDK8-2151HF | Active Recombinant Full Length Human CDK8 Protein, GST-tagged | +Inquiry | 
| CDK8-1038H | Active Recombinant Human CDK8 Protein, GST-Tagged | +Inquiry | 
| CDK8-616R | Recombinant Rhesus Macaque CDK8 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CDK8-1531M | Recombinant Mouse CDK8 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CDK8-6878HF | Recombinant Full Length Human CDK8 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CDK8-7620HCL | Recombinant Human CDK8 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK8 Products
Required fields are marked with *
My Review for All CDK8 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            