Recombinant Human CDKN2A protein, GST-tagged

Cat.No. : CDKN2A-3720H
Product Overview : Recombinant Human CDKN2A protein(55-156 aa), fused to GST tag, was expressed in E. coli.
Availability January 30, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 55-156 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : SARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CDKN2A cyclin-dependent kinase inhibitor 2A [ Homo sapiens ]
Official Symbol CDKN2A
Synonyms CDKN2A; cyclin-dependent kinase inhibitor 2A; CDKN2, cyclin dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) , MLM; ARF; CDK4I; CMM2; INK4; INK4a; MTS1; p14; p16; p16INK4a; p19; p19Arf; CDK4 inhibitor p16-INK4; multiple tumor suppressor 1; cell cycle negative regulator beta; cyclin-dependent kinase 4 inhibitor A; cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4); MLM; P14; P16; P19; TP16; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A;
Gene ID 1029
mRNA Refseq NM_000077
Protein Refseq NP_000068
MIM 600160
UniProt ID P42771

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKN2A Products

Required fields are marked with *

My Review for All CDKN2A Products

Required fields are marked with *

0
cart-icon
0
compare icon