Recombinant Human CDKN2A protein, GST-tagged
Cat.No. : | CDKN2A-3720H |
Product Overview : | Recombinant Human CDKN2A protein(55-156 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 55-156 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | SARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDKN2A cyclin-dependent kinase inhibitor 2A [ Homo sapiens ] |
Official Symbol | CDKN2A |
Synonyms | CDKN2A; cyclin-dependent kinase inhibitor 2A; CDKN2, cyclin dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) , MLM; ARF; CDK4I; CMM2; INK4; INK4a; MTS1; p14; p16; p16INK4a; p19; p19Arf; CDK4 inhibitor p16-INK4; multiple tumor suppressor 1; cell cycle negative regulator beta; cyclin-dependent kinase 4 inhibitor A; cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4); MLM; P14; P16; P19; TP16; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A; |
Gene ID | 1029 |
mRNA Refseq | NM_000077 |
Protein Refseq | NP_000068 |
MIM | 600160 |
UniProt ID | P42771 |
◆ Recombinant Proteins | ||
CDKN2A-655H | Recombinant Human CDKN2A protein | +Inquiry |
CDKN2A-7704H | Recombinant Human CDKN2A protein, His & T7-tagged | +Inquiry |
CDKN2A-0979H | Recombinant Human CDKN2A Protein (Met1-Asp156), N-His tagged | +Inquiry |
Cdkn2a-7706R | Recombinant Rat Cdkn2a protein, His & T7-tagged | +Inquiry |
CDKN2A-4499H | Recombinant Human CDKN2A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN2A-7616HCL | Recombinant Human CDKN2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2A Products
Required fields are marked with *
My Review for All CDKN2A Products
Required fields are marked with *