Recombinant Human CDKN2B protein, His&Myc-tagged
Cat.No. : | CDKN2B-2681H |
Product Overview : | Recombinant Human CDKN2B protein(P42772)(1-138aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-138aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CDKN2B cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) [ Homo sapiens ] |
Official Symbol | CDKN2B |
Synonyms | CDKN2B; cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); cyclin-dependent kinase 4 inhibitor B; CDK4I; INK4B; MTS2; P15; p15INK4b; TP15; MTS-2; p14-INK4b; p14_INK4B; p15-INK4b; p15_INK4B; CDK4B inhibitor; p14_CDK inhibitor; p15 CDK inhibitor; CDK inhibitory protein; multiple tumor suppressor 2; cyclin-dependent kinases 4 and 6 binding protein; |
Gene ID | 1030 |
mRNA Refseq | NM_004936 |
Protein Refseq | NP_004927 |
MIM | 600431 |
UniProt ID | P42772 |
◆ Recombinant Proteins | ||
CDKN2B-1316R | Recombinant Rat CDKN2B Protein | +Inquiry |
CDKN2B-974R | Recombinant Rat CDKN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKN2B-4212H | Recombinant Human CDKN2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDKN2B-6003C | Recombinant Chicken CDKN2B | +Inquiry |
CDKN2B-1064H | Recombinant Human CDKN2B Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN2B-7613HCL | Recombinant Human CDKN2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2B Products
Required fields are marked with *
My Review for All CDKN2B Products
Required fields are marked with *
0
Inquiry Basket