Recombinant Human CDKN2B protein, His-tagged
| Cat.No. : | CDKN2B-134H |
| Product Overview : | Recombinant Human CDKN2B(1-138aa) fused with His tag at N-terminal was expressed in E. coli. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-138aa |
| Description : | This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The ex |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
| AA Sequence : | MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCA DPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD |
| Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | CDKN2B cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) [ Homo sapiens ] |
| Official Symbol | CDKN2B |
| Synonyms | CDKN2B; cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); cyclin-dependent kinase 4 inhibitor B; CDK4I; INK4B; MTS2; P15; p15INK4b; TP15; MTS-2; p14-INK4b; p14_INK4B; p15-INK4b; p15_INK4B; CDK4B inhibitor; p14_CDK inhibitor; p15 CDK inhibitor; CDK inhibitory protein; multiple tumor suppressor 2; cyclin-dependent kinases 4 and 6 binding protein; |
| Gene ID | 1030 |
| mRNA Refseq | NM_004936 |
| Protein Refseq | NP_004927 |
| MIM | 600431 |
| UniProt ID | P42772 |
| Chromosome Location | 9p21 |
| Pathway | Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Cyclin D associated events in G1, organism-specific biosystem; G1 Phase, organism-specific biosystem; G1 to S cell cycle control, organism-specific biosystem; |
| Function | cyclin-dependent protein kinase inhibitor activity; cyclin-dependent protein kinase inhibitor activity; kinase activity; protein binding; protein kinase binding; |
| ◆ Recombinant Proteins | ||
| CDKN2B-1540M | Recombinant Mouse CDKN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDKN2B-134H | Recombinant Human CDKN2B protein, His-tagged | +Inquiry |
| CDKN2B-3226M | Recombinant Mouse CDKN2B Protein | +Inquiry |
| CDKN2B-1064H | Recombinant Human CDKN2B Protein, GST-Tagged | +Inquiry |
| CDKN2B-2681H | Recombinant Human CDKN2B protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDKN2B-7613HCL | Recombinant Human CDKN2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2B Products
Required fields are marked with *
My Review for All CDKN2B Products
Required fields are marked with *
