Recombinant Human CDKN2C, His-tagged
| Cat.No. : | CDKN2C-30048TH |
| Product Overview : | Recombinant full length Human p18 INK4c (amino acids 1-168) fused to His tag at N-terminus; 192aa, 20.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 168 amino acids |
| Description : | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. |
| Conjugation : | HIS |
| Molecular Weight : | 20.700kDa inclusive of tags |
| Tissue specificity : | Highest levels found in skeletal muscle. Also found in pancreas and heart. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 1.17% Sodium chloride |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQ LTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIED NEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTA CDLARLYGRNEVVSLMQANGAGGATNLQ |
| Sequence Similarities : | Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.Contains 4 ANK repeats. |
| Gene Name | CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ] |
| Official Symbol | CDKN2C |
| Synonyms | CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; |
| Gene ID | 1031 |
| mRNA Refseq | NM_001262 |
| Protein Refseq | NP_001253 |
| MIM | 603369 |
| Uniprot ID | P42773 |
| Chromosome Location | 1p32.3 |
| Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Cyclin D associated events in G1, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; |
| Function | cyclin-dependent protein kinase inhibitor activity; protein kinase binding; |
| ◆ Recombinant Proteins | ||
| Cdkn2c-6983H | Recombinant Human p18INK4C, GST-tagged | +Inquiry |
| CDKN2C-1377H | Recombinant Human Cyclin-Dependent Kinase Inhibitor 2C (p18, inhibits CDK4), His-tagged | +Inquiry |
| CDKN2C-2988H | Recombinant Human CDKN2C protein, His-tagged | +Inquiry |
| CDKN2C-622R | Recombinant Rhesus Macaque CDKN2C Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDKN2C-1475H | Recombinant Human CDKN2C, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDKN2C-333HKCL | Human CDKN2C Knockdown Cell Lysate | +Inquiry |
| CDKN2C-7612HCL | Recombinant Human CDKN2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2C Products
Required fields are marked with *
My Review for All CDKN2C Products
Required fields are marked with *
