Recombinant Human CDKN2C Protein, GST-Tagged
Cat.No. : | CDKN2C-1065H |
Product Overview : | Human CDKN2C full-length ORF (AAH16173, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44.22 kDa |
AA Sequence : | MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHMASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ] |
Official Symbol | CDKN2C |
Synonyms | CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18; p18-INK4C; |
Gene ID | 1031 |
mRNA Refseq | NM_001262 |
Protein Refseq | NP_001253 |
MIM | 603369 |
UniProt ID | P42773 |
◆ Recombinant Proteins | ||
CDKN2C-1065H | Recombinant Human CDKN2C Protein, GST-Tagged | +Inquiry |
CDKN2C-3049H | Recombinant Human CDKN2C, T7-tagged | +Inquiry |
CDKN2C-796R | Recombinant Rhesus monkey CDKN2C Protein, His-tagged | +Inquiry |
CDKN2C-3230HF | Recombinant Full Length Human CDKN2C Protein, GST-tagged | +Inquiry |
CDKN2C-1475H | Recombinant Human CDKN2C, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN2C-7612HCL | Recombinant Human CDKN2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDKN2C Products
Required fields are marked with *
My Review for All CDKN2C Products
Required fields are marked with *
0
Inquiry Basket