Recombinant Human CDO1 Protein, GST-Tagged

Cat.No. : CDO1-1069H
Product Overview : Human CDO1 full-length ORF (NP_001792.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDO1 (Cysteine Dioxygenase Type 1) is a Protein Coding gene. Diseases associated with CDO1 include Hepatoblastoma. Among its related pathways are Viral mRNA Translation and Sulfur amino acid metabolism. GO annotations related to this gene include iron ion binding and cysteamine dioxygenase activity.
Molecular Mass : 49.4 kDa
AA Sequence : MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDO1 cysteine dioxygenase, type I [ Homo sapiens ]
Official Symbol CDO1
Synonyms CDO1; cysteine dioxygenase, type I; cysteine dioxygenase type 1; CDO; CDO-I;
Gene ID 1036
mRNA Refseq NM_001801
Protein Refseq NP_001792
MIM 603943
UniProt ID Q16878

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDO1 Products

Required fields are marked with *

My Review for All CDO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon