Recombinant Human CDO1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CDO1-1371H
Product Overview : CDO1 MS Standard C13 and N15-labeled recombinant protein (NP_001792) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
Molecular Mass : 23 kDa
AA Sequence : MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CDO1 cysteine dioxygenase type 1 [ Homo sapiens (human) ]
Official Symbol CDO1
Synonyms CDO1; cysteine dioxygenase, type I; cysteine dioxygenase type 1; CDO; CDO-I;
Gene ID 1036
mRNA Refseq NM_001801
Protein Refseq NP_001792
MIM 603943
UniProt ID Q16878

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDO1 Products

Required fields are marked with *

My Review for All CDO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon