Recombinant Human CDO1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDO1-1371H |
Product Overview : | CDO1 MS Standard C13 and N15-labeled recombinant protein (NP_001792) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range. |
Molecular Mass : | 23 kDa |
AA Sequence : | MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDO1 cysteine dioxygenase type 1 [ Homo sapiens (human) ] |
Official Symbol | CDO1 |
Synonyms | CDO1; cysteine dioxygenase, type I; cysteine dioxygenase type 1; CDO; CDO-I; |
Gene ID | 1036 |
mRNA Refseq | NM_001801 |
Protein Refseq | NP_001792 |
MIM | 603943 |
UniProt ID | Q16878 |
◆ Recombinant Proteins | ||
CDO1-3231M | Recombinant Mouse CDO1 Protein | +Inquiry |
CDO1-1069H | Recombinant Human CDO1 Protein, GST-Tagged | +Inquiry |
CDO1-1542M | Recombinant Mouse CDO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDO1-1371H | Recombinant Human CDO1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDO1-1317R | Recombinant Rat CDO1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDO1-7608HCL | Recombinant Human CDO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDO1 Products
Required fields are marked with *
My Review for All CDO1 Products
Required fields are marked with *