Recombinant Human CEACAM21 Protein, GST-Tagged
Cat.No. : | CEACAM21-1094H |
Product Overview : | Human CEACAM21 full-length ORF (AAH12001.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CEACAM21 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 21) is a Protein Coding gene. An important paralog of this gene is CEACAM1. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEACAM21 carcinoembryonic antigen-related cell adhesion molecule 21 [ Homo sapiens ] |
Official Symbol | CEACAM21 |
Synonyms | CEACAM21; carcinoembryonic antigen-related cell adhesion molecule 21; FLJ13540; R29124_1; CEACAM3; MGC119874; |
Gene ID | 90273 |
mRNA Refseq | NM_001098506 |
Protein Refseq | NP_001091976 |
UniProt ID | Q3KPI0 |
◆ Recombinant Proteins | ||
CEACAM21-15898H | Recombinant Human CEACAM21, His-tagged | +Inquiry |
CEACAM21-033H | Recombinant Human CEACAM21 protein, HIS-tagged | +Inquiry |
CEACAM21-1094H | Recombinant Human CEACAM21 Protein, GST-Tagged | +Inquiry |
CEACAM21-1535H | Recombinant Human CEACAM21 Protein (Trp35-Gly240), C-His tagged | +Inquiry |
CEACAM21-3273HF | Recombinant Full Length Human CEACAM21 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM21-7599HCL | Recombinant Human CEACAM21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM21 Products
Required fields are marked with *
My Review for All CEACAM21 Products
Required fields are marked with *
0
Inquiry Basket