Recombinant Human CEACAM3 Protein, His-SUMO-tagged
| Cat.No. : | CEACAM3-1160H |
| Product Overview : | Recombinant Human CEACAM3 Protein (35-155aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 35-155 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 29.1 kDa |
| AA Sequence : | KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTN ASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3 [ Homo sapiens ] |
| Official Symbol | CEACAM3 |
| Synonyms | CEACAM3; carcinoembryonic antigen-related cell adhesion molecule 3; CD66d antigen; OTTHUMP00000196409; carcinoembryonic antigen CGM1; carcinoembryonic antigen gene family member 1; nonspecific cross-reacting antigen; CEA; CGM1; W264; W282; CD66D; MGC119875 |
| Gene ID | 1084 |
| mRNA Refseq | NM_001815 |
| Protein Refseq | NP_001806 |
| MIM | 609142 |
| UniProt ID | P40198 |
| ◆ Cell & Tissue Lysates | ||
| CEACAM3-2074HCL | Recombinant Human CEACAM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM3 Products
Required fields are marked with *
My Review for All CEACAM3 Products
Required fields are marked with *



