Recombinant Human CEACAM3 Protein, His-SUMO-tagged
Cat.No. : | CEACAM3-1160H |
Product Overview : | Recombinant Human CEACAM3 Protein (35-155aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 35-155 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTN ASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3 [ Homo sapiens ] |
Official Symbol | CEACAM3 |
Synonyms | CEACAM3; carcinoembryonic antigen-related cell adhesion molecule 3; CD66d antigen; OTTHUMP00000196409; carcinoembryonic antigen CGM1; carcinoembryonic antigen gene family member 1; nonspecific cross-reacting antigen; CEA; CGM1; W264; W282; CD66D; MGC119875 |
Gene ID | 1084 |
mRNA Refseq | NM_001815 |
Protein Refseq | NP_001806 |
MIM | 609142 |
UniProt ID | P40198 |
◆ Recombinant Proteins | ||
Ceacam3-8195R | Recombinant Rat Ceacam3 protein, His-tagged | +Inquiry |
RFL16169HF | Recombinant Full Length Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3(Ceacam3) Protein, His-Tagged | +Inquiry |
CEACAM3-2661H | Active Recombinant Human CEACAM3 protein, His-tagged | +Inquiry |
CEACAM3-2698H | Recombinant Human CEACAM3 | +Inquiry |
CEACAM3-676H | Recombinant Human carcinoembryonic antigen-related cell adhesion molecule 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM3-2074HCL | Recombinant Human CEACAM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM3 Products
Required fields are marked with *
My Review for All CEACAM3 Products
Required fields are marked with *
0
Inquiry Basket