Recombinant Human CEACAM3 Protein, His-SUMO-tagged

Cat.No. : CEACAM3-1160H
Product Overview : Recombinant Human CEACAM3 Protein (35-155aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 35-155 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 29.1 kDa
AA Sequence : KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTN
ASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3 [ Homo sapiens ]
Official Symbol CEACAM3
Synonyms CEACAM3; carcinoembryonic antigen-related cell adhesion molecule 3; CD66d antigen; OTTHUMP00000196409; carcinoembryonic antigen CGM1; carcinoembryonic antigen gene family member 1; nonspecific cross-reacting antigen; CEA; CGM1; W264; W282; CD66D; MGC119875
Gene ID 1084
mRNA Refseq NM_001815
Protein Refseq NP_001806
MIM 609142
UniProt ID P40198

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM3 Products

Required fields are marked with *

My Review for All CEACAM3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon