Recombinant human CEACAM8 protein, His-tagged
| Cat.No. : | CEACAM8-04H |
| Product Overview : | Recombinant human CEACAM-8 protein (35-320aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect cells |
| Tag : | His |
| Protein Length : | 35-320 a.a. |
| Description : | Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils. |
| Form : | Liquid |
| Molecular Mass : | 32.3 kDa |
| AA Sequence : | QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | CEACAM8 CEA cell adhesion molecule 8 [ Homo sapiens (human) ] |
| Official Symbol | CEACAM8 |
| Synonyms | CEACAM8; CEA cell adhesion molecule 8; CD67; CGM6; CD66b; NCA-95; carcinoembryonic antigen-related cell adhesion molecule 8; CD67 antigen; carcinoembryonic antigen CGM6; carcinoembryonic antigen gene family member 6; carcinoembryonic antigen related cell adhesion molecule 8; non-specific cross-reacting antigen NCA-95 |
| Gene ID | 1088 |
| mRNA Refseq | NM_001816 |
| Protein Refseq | NP_001807 |
| MIM | 615747 |
| UniProt ID | P31997 |
| ◆ Recombinant Proteins | ||
| CEACAM8-3234H | Active Recombinant Human CEACAM8 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| CEACAM8-3941H | Recombinant Human CEACAM8 Protein (Met1-Asp320), C-His tagged | +Inquiry |
| CEACAM8-04H | Recombinant human CEACAM8 protein, His-tagged | +Inquiry |
| CEACAM8-0849H | Recombinant Human CEACAM8 Protein (Gln35-Asp320), His tagged | +Inquiry |
| CEACAM8-2983H | Active Recombinant Human CEACAM8 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM8 Products
Required fields are marked with *
My Review for All CEACAM8 Products
Required fields are marked with *



