Recombinant human CEACAM8 protein, His-tagged
Cat.No. : | CEACAM8-04H |
Product Overview : | Recombinant human CEACAM-8 protein (35-320aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 35-320 a.a. |
Description : | Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils. |
Form : | Liquid |
Molecular Mass : | 32.3 kDa |
AA Sequence : | QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL |
Storage Buffer : | In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | CEACAM8 CEA cell adhesion molecule 8 [ Homo sapiens (human) ] |
Official Symbol | CEACAM8 |
Synonyms | CEACAM8; CEA cell adhesion molecule 8; CD67; CGM6; CD66b; NCA-95; carcinoembryonic antigen-related cell adhesion molecule 8; CD67 antigen; carcinoembryonic antigen CGM6; carcinoembryonic antigen gene family member 6; carcinoembryonic antigen related cell adhesion molecule 8; non-specific cross-reacting antigen NCA-95 |
Gene ID | 1088 |
mRNA Refseq | NM_001816 |
Protein Refseq | NP_001807 |
MIM | 615747 |
UniProt ID | P31997 |
◆ Recombinant Proteins | ||
CEACAM8-180H | Recombinant Human CEACAM8 Protein, His-tagged | +Inquiry |
CEACAM8-3234H | Active Recombinant Human CEACAM8 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CEACAM8-3941H | Recombinant Human CEACAM8 Protein (Met1-Asp320), C-His tagged | +Inquiry |
CEACAM8-1098H | Recombinant Human CEACAM8 Protein, GST-Tagged | +Inquiry |
CEACAM8-0849H | Recombinant Human CEACAM8 Protein (Gln35-Asp320), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM8 Products
Required fields are marked with *
My Review for All CEACAM8 Products
Required fields are marked with *
0
Inquiry Basket