Recombinant human CEACAM8 protein, His-tagged

• Cat.No.: CEACAM8-04H
• Product Overview: Recombinant human CEACAM-8 protein (35-320aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 35-320 a.a.
• Description: Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.
• Form: Liquid
• Molecular Mass: 32.3 kDa
• AA Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: CEACAM8 CEA cell adhesion molecule 8 [ Homo sapiens (human) ]
• Official Symbol: CEACAM8
• Synonyms: CEACAM8; CEA cell adhesion molecule 8; CD67; CGM6; CD66b; NCA-95; carcinoembryonic antigen-related cell adhesion molecule 8; CD67 antigen; carcinoembryonic antigen CGM6; carcinoembryonic antigen gene family member 6; carcinoembryonic antigen related cell adhesion molecule 8; non-specific cross-reacting antigen NCA-95
• Gene ID: 1088
• mRNA Refseq: NM_001816
• Protein Refseq: NP_001807
• MIM: 615747
• UniProt ID: P31997