Recombinant human CEACAM8 protein, His-tagged

Cat.No. : CEACAM8-04H
Product Overview : Recombinant human CEACAM-8 protein (35-320aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 35-320 a.a.
Description : Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.
Form : Liquid
Molecular Mass : 32.3 kDa
AA Sequence : QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name CEACAM8 CEA cell adhesion molecule 8 [ Homo sapiens (human) ]
Official Symbol CEACAM8
Synonyms CEACAM8; CEA cell adhesion molecule 8; CD67; CGM6; CD66b; NCA-95; carcinoembryonic antigen-related cell adhesion molecule 8; CD67 antigen; carcinoembryonic antigen CGM6; carcinoembryonic antigen gene family member 6; carcinoembryonic antigen related cell adhesion molecule 8; non-specific cross-reacting antigen NCA-95
Gene ID 1088
mRNA Refseq NM_001816
Protein Refseq NP_001807
MIM 615747
UniProt ID P31997

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM8 Products

Required fields are marked with *

My Review for All CEACAM8 Products

Required fields are marked with *

0
cart-icon