Recombinant Human CEBPB, His-tagged
Cat.No. : | CEBPB-27010TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 125-345 of Human CEBP Beta with N terminal His tag; Predicted MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 125-345 a.a. |
Description : | The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene. |
Conjugation : | HIS |
Tissue specificity : | Expressed at low levels in the lung, kidney and spleen. |
Form : | Lyophilised:Reconstitute with 85 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPP PPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAG FPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRR ERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC |
Sequence Similarities : | Belongs to the bZIP family. C/EBP subfamily.Contains 1 bZIP domain. |
Gene Name | CEBPB CCAAT/enhancer binding protein (C/EBP), beta [ Homo sapiens ] |
Official Symbol | CEBPB |
Synonyms | CEBPB; CCAAT/enhancer binding protein (C/EBP), beta; TCF5; CCAAT/enhancer-binding protein beta; C/EBP beta; CRP2; IL6DBP; interleukin 6 dependent DNA binding protein; LAP; liver enriched transcriptional activator protein; NFIL6; nuclear factor of interleu |
Gene ID | 1051 |
mRNA Refseq | NM_005194 |
Protein Refseq | NP_005185 |
MIM | 189965 |
Uniprot ID | P17676 |
Chromosome Location | 20q13.1 |
Pathway | Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; |
Function | DNA binding; glucocorticoid receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
CEBPB-573H | Recombinant Human CEBPB Protein, His (Fc)-Avi-tagged | +Inquiry |
CEBPB-3260M | Recombinant Mouse CEBPB Protein | +Inquiry |
Cebpb-876M | Recombinant Mouse Cebpb Protein, MYC/DDK-tagged | +Inquiry |
CEBPB-3782H | Recombinant Human CEBPB Protein, His-tagged | +Inquiry |
CEBPB-0892H | Recombinant Human CEBPB Protein (Val259-Cys345), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEBPB-7598HCL | Recombinant Human CEBPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEBPB Products
Required fields are marked with *
My Review for All CEBPB Products
Required fields are marked with *