Recombinant Human CEBPB, His-tagged
| Cat.No. : | CEBPB-27010TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 125-345 of Human CEBP Beta with N terminal His tag; Predicted MWt 26 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 125-345 a.a. | 
| Description : | The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene. | 
| Conjugation : | HIS | 
| Tissue specificity : | Expressed at low levels in the lung, kidney and spleen. | 
| Form : | Lyophilised:Reconstitute with 85 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | DYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPP PPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAG FPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRR ERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC | 
| Sequence Similarities : | Belongs to the bZIP family. C/EBP subfamily.Contains 1 bZIP domain. | 
| Gene Name | CEBPB CCAAT/enhancer binding protein (C/EBP), beta [ Homo sapiens ] | 
| Official Symbol | CEBPB | 
| Synonyms | CEBPB; CCAAT/enhancer binding protein (C/EBP), beta; TCF5; CCAAT/enhancer-binding protein beta; C/EBP beta; CRP2; IL6DBP; interleukin 6 dependent DNA binding protein; LAP; liver enriched transcriptional activator protein; NFIL6; nuclear factor of interleu | 
| Gene ID | 1051 | 
| mRNA Refseq | NM_005194 | 
| Protein Refseq | NP_005185 | 
| MIM | 189965 | 
| Uniprot ID | P17676 | 
| Chromosome Location | 20q13.1 | 
| Pathway | Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; | 
| Function | DNA binding; glucocorticoid receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity; | 
| ◆ Recombinant Proteins | ||
| CEBPB-3782H | Recombinant Human CEBPB Protein, His-tagged | +Inquiry | 
| CEBPB-3260M | Recombinant Mouse CEBPB Protein | +Inquiry | 
| CEBPB-1560M | Recombinant Mouse CEBPB Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CEBPB-983R | Recombinant Rat CEBPB Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Cebpb-737M | Recombinant Mouse Cebpb Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CEBPB-7598HCL | Recombinant Human CEBPB 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEBPB Products
Required fields are marked with *
My Review for All CEBPB Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            