Recombinant Human CELA3A Protein (inactive variant S217A, AA 16-270), C-His-Tagged
Cat.No. : | CELA3A-29H |
Product Overview : | Recombinant Human CELA3A Protein (inactive variant S217A, AA 16-270) with a C-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | AA 16-270 |
Description : | Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1. |
Form : | Liquid |
AA Sequence : | MSGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLT YQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAG DILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGC NGDAGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASHVLVPRGSAAALE |
Purity : | > 90% as determined by SDS-PAGE |
Storage : | Stored and shipped at -80 centigrade |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | CELA3A chymotrypsin-like elastase family, member 3A [ Homo sapiens ] |
Official Symbol | CELA3A |
Synonyms | CELA3A; chymotrypsin-like elastase family, member 3A; ELA3A, elastase 3A, pancreatic , elastase 3A, pancreatic (protease E); chymotrypsin-like elastase family member 3A; ELA3; protease E; elastase 1; elastase-3A; elastase IIIA; elastase 3A, pancreatic; ELA3A |
Gene ID | 10136 |
mRNA Refseq | NM_005747 |
Protein Refseq | NP_005738 |
UniProt ID | P09093 |
◆ Recombinant Proteins | ||
CELA3A-1162H | Recombinant Human CELA3A protein, His & GST-tagged | +Inquiry |
CELA3A-2845H | Recombinant Human CELA3A protein, His-SUMO-tagged | +Inquiry |
CELA3A-3224H | Recombinant Human CELA3A Protein, GST-tagged | +Inquiry |
CELA3A-1105H | Recombinant Human CELA3A Protein (Ser16-His270), C-His tagged | +Inquiry |
CELA3A-29H | Recombinant Human CELA3A Protein (inactive variant S217A, AA 16-270), C-His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA3A-7592HCL | Recombinant Human CELA3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CELA3A Products
Required fields are marked with *
My Review for All CELA3A Products
Required fields are marked with *
0
Inquiry Basket