Recombinant Human CELA3A Protein (inactive variant S217A, AA 16-270), C-His-Tagged

Cat.No. : CELA3A-29H
Product Overview : Recombinant Human CELA3A Protein (inactive variant S217A, AA 16-270) with a C-His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : AA 16-270
Description : Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1.
Form : Liquid
AA Sequence : MSGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLT YQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAG DILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGC NGDAGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASHVLVPRGSAAALE
Purity : > 90% as determined by SDS-PAGE
Storage : Stored and shipped at -80 centigrade
Storage Buffer : PBS, pH 7.4
Gene Name CELA3A chymotrypsin-like elastase family, member 3A [ Homo sapiens ]
Official Symbol CELA3A
Synonyms CELA3A; chymotrypsin-like elastase family, member 3A; ELA3A, elastase 3A, pancreatic , elastase 3A, pancreatic (protease E); chymotrypsin-like elastase family member 3A; ELA3; protease E; elastase 1; elastase-3A; elastase IIIA; elastase 3A, pancreatic; ELA3A
Gene ID 10136
mRNA Refseq NM_005747
Protein Refseq NP_005738
UniProt ID P09093

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CELA3A Products

Required fields are marked with *

My Review for All CELA3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon