Recombinant Human CELA3B protein, His-tagged
| Cat.No. : | CELA3B-1165H |
| Product Overview : | Recombinant Human CELA3B protein(P08861)(29-270aa), fused to N-terminal His tag, was expressed in Baculovirus-Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 29-270aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.8kDa |
| AA Sequence : | VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CELA3B chymotrypsin like elastase family member 3B [ Homo sapiens (human) ] |
| Official Symbol | CELA3B |
| Synonyms | CELA3B; chymotrypsin like elastase family member 3B; CBPP; ELA3B; chymotrypsin-like elastase family member 3B; cholesterol-binding pancreatic protease; elastase 3B, pancreatic; elastase IIIB; elastase-3B; fecal elastase 1; pancreatic elastase 1; pancreatic endopeptidase E; protease E; proteinase E |
| Gene ID | 23436 |
| mRNA Refseq | NM_007352 |
| Protein Refseq | NP_031378 |
| UniProt ID | P08861 |
| ◆ Recombinant Proteins | ||
| CELA3B-1163H | Recombinant Human CELA3B protein, His-tagged | +Inquiry |
| Cela3b-1164R | Recombinant Rat Cela3b protein, His-tagged | +Inquiry |
| CELA3B-2422M | Recombinant Mouse CELA3B Protein (28-269 aa), His-Myc-tagged | +Inquiry |
| CELA3B-1165H | Recombinant Human CELA3B protein, His-tagged | +Inquiry |
| CELA3B-65H | Recombinant Human CELA3B, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CELA3B-7591HCL | Recombinant Human CELA3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELA3B Products
Required fields are marked with *
My Review for All CELA3B Products
Required fields are marked with *



