Recombinant Human CELA3B protein, His-tagged

Cat.No. : CELA3B-1165H
Product Overview : Recombinant Human CELA3B protein(P08861)(29-270aa), fused to N-terminal His tag, was expressed in Baculovirus-Insect cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 29-270aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.8kDa
AA Sequence : VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name CELA3B chymotrypsin like elastase family member 3B [ Homo sapiens (human) ]
Official Symbol CELA3B
Synonyms CELA3B; chymotrypsin like elastase family member 3B; CBPP; ELA3B; chymotrypsin-like elastase family member 3B; cholesterol-binding pancreatic protease; elastase 3B, pancreatic; elastase IIIB; elastase-3B; fecal elastase 1; pancreatic elastase 1; pancreatic endopeptidase E; protease E; proteinase E
Gene ID 23436
mRNA Refseq NM_007352
Protein Refseq NP_031378
UniProt ID P08861

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELA3B Products

Required fields are marked with *

My Review for All CELA3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon