Recombinant Human CELA3B protein, His-tagged
Cat.No. : | CELA3B-1165H |
Product Overview : | Recombinant Human CELA3B protein(P08861)(29-270aa), fused to N-terminal His tag, was expressed in Baculovirus-Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 29-270aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.8kDa |
AA Sequence : | VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CELA3B chymotrypsin like elastase family member 3B [ Homo sapiens (human) ] |
Official Symbol | CELA3B |
Synonyms | CELA3B; chymotrypsin like elastase family member 3B; CBPP; ELA3B; chymotrypsin-like elastase family member 3B; cholesterol-binding pancreatic protease; elastase 3B, pancreatic; elastase IIIB; elastase-3B; fecal elastase 1; pancreatic elastase 1; pancreatic endopeptidase E; protease E; proteinase E |
Gene ID | 23436 |
mRNA Refseq | NM_007352 |
Protein Refseq | NP_031378 |
UniProt ID | P08861 |
◆ Recombinant Proteins | ||
CELA3B-3470H | Recombinant Human CELA3B Protein (Val31-His270), His tagged | +Inquiry |
CELA3B-1566M | Recombinant Mouse CELA3B Protein, His (Fc)-Avi-tagged | +Inquiry |
CELA3B-2422M | Recombinant Mouse CELA3B Protein (28-269 aa), His-Myc-tagged | +Inquiry |
CELA3B-3469H | Recombinant Human CELA3B Protein (Asp34-His270), N-His tagged | +Inquiry |
CELA3B-3271M | Recombinant Mouse CELA3B Protein | +Inquiry |
◆ Native Proteins | ||
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA3B-7591HCL | Recombinant Human CELA3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CELA3B Products
Required fields are marked with *
My Review for All CELA3B Products
Required fields are marked with *
0
Inquiry Basket