Recombinant Human CELF1 protein, His-tagged
Cat.No. : | CELF1-6334H |
Product Overview : | Recombinant Human CELF1 protein(Q92879)(1-486aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-486a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 59.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY |
Gene Name | CELF1 CUGBP, Elav-like family member 1 [ Homo sapiens ] |
Official Symbol | CELF1 |
Synonyms | CELF1; CUGBP, Elav-like family member 1; CUG triplet repeat, RNA binding protein 1 , CUG triplet repeat, RNA binding protein 1 , CUGBP1; CUGBP Elav-like family member 1; bruno like 2; BRUNOL2; CUG RNA binding protein; CUG BP; CUGBP; EDEN BP; embryo deadenylation element binding protein; hNab50; NAB50; NAPOR; nuclear polyadenylated RNA binding protein; 50 kD; CELF-1; CUG-BP1; bruno-like 2; EDEN-BP homolog; bruno-like protein 2; CUG RNA-binding protein; deadenylation factor CUG-BP; RNA-binding protein BRUNOL-2; CUG-BP- and ETR-3-like factor 1; CUG triplet repeat RNA-binding protein 1; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; 50 kDa nuclear polyadenylated RNA-binding protein; nuclear polyadenylated RNA-binding protein, 50-kD; embryo deadenylation element-binding protein homolog; CUG-BP; CUGBP1; EDEN-BP; |
Gene ID | 10658 |
mRNA Refseq | NM_001025596 |
Protein Refseq | NP_001020767 |
MIM | 601074 |
UniProt ID | Q92879 |
◆ Recombinant Proteins | ||
CELF1-1896C | Recombinant Chicken CELF1 | +Inquiry |
Celf1-2100M | Recombinant Mouse Celf1 Protein, Myc/DDK-tagged | +Inquiry |
CELF1-705H | Recombinant Human CELF1 protein(T173E,S178D,S285D,S288D,S295D,S296D,S298D) | +Inquiry |
CELF1-988R | Recombinant Rat CELF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CELF1-2391HF | Recombinant Full Length Human CELF1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELF1-7589HCL | Recombinant Human CELF1 293 Cell Lysate | +Inquiry |
CELF1-7590HCL | Recombinant Human CELF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELF1 Products
Required fields are marked with *
My Review for All CELF1 Products
Required fields are marked with *