Recombinant Full Length Human CELF1 Protein, GST-tagged
Cat.No. : | CELF1-2391HF |
Product Overview : | Human CUGBP1 full-length ORF ( NP_941989.1, 1 a.a. - 483 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 483 amino acids |
Description : | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 78 kDa |
AA Sequence : | MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CELF1 CUGBP, Elav-like family member 1 [ Homo sapiens ] |
Official Symbol | CELF1 |
Synonyms | CELF1; CUGBP, Elav-like family member 1; CUG triplet repeat, RNA binding protein 1 , CUG triplet repeat, RNA binding protein 1 , CUGBP1; CUGBP Elav-like family member 1; bruno like 2; BRUNOL2; CUG RNA binding protein; CUG BP; CUGBP; EDEN BP; embryo deadenylation element binding protein; hNab50; NAB50; NAPOR; nuclear polyadenylated RNA binding protein; 50 kD; CELF-1; CUG-BP1; bruno-like 2; EDEN-BP homolog; bruno-like protein 2; CUG RNA-binding protein; deadenylation factor CUG-BP; RNA-binding protein BRUNOL-2; CUG-BP- and ETR-3-like factor 1; CUG triplet repeat RNA-binding protein 1; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; 50 kDa nuclear polyadenylated RNA-binding protein; nuclear polyadenylated RNA-binding protein, 50-kD; embryo deadenylation element-binding protein homolog; CUG-BP; CUGBP1; EDEN-BP; |
Gene ID | 10658 |
mRNA Refseq | NM_001025596 |
Protein Refseq | NP_001020767 |
MIM | 601074 |
UniProt ID | Q92879 |
◆ Recombinant Proteins | ||
CELF1-705H | Recombinant Human CELF1 protein(T173E,S178D,S285D,S288D,S295D,S296D,S298D) | +Inquiry |
CELF1-988R | Recombinant Rat CELF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CELF1-707H | Recombinant Human CELF1 protein(T173E,S178D,S285D,S288D,S295D,S296D,S298D) | +Inquiry |
CELF1-3272M | Recombinant Mouse CELF1 Protein | +Inquiry |
CELF1-2391HF | Recombinant Full Length Human CELF1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELF1-7590HCL | Recombinant Human CELF1 293 Cell Lysate | +Inquiry |
CELF1-7589HCL | Recombinant Human CELF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELF1 Products
Required fields are marked with *
My Review for All CELF1 Products
Required fields are marked with *