Recombinant Human CELF1 protein(T173E,S178D,S285D,S288D,S295D,S296D,S298D)

Cat.No. : CELF1-707H
Product Overview : Recombinant Human CELF1 protein(Q92879)(1-475aa (T173E,S178D,S285D,S288D,S295D,S296D,S298D)), was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-475aa (T173E,S178D,S285D,S288D,S295D,S296D,S298D)
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 53.0 kDa
AA Sequence : MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRMLRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQEMEGCDSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSDPLDVLTSSGDDPDSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CELF1 CUGBP, Elav-like family member 1 [ Homo sapiens ]
Official Symbol CELF1
Synonyms CELF1; CUGBP, Elav-like family member 1; CUG triplet repeat, RNA binding protein 1 , CUG triplet repeat, RNA binding protein 1 , CUGBP1; CUGBP Elav-like family member 1; bruno like 2; BRUNOL2; CUG RNA binding protein; CUG BP; CUGBP; EDEN BP; embryo deadenylation element binding protein; hNab50; NAB50; NAPOR; nuclear polyadenylated RNA binding protein; 50 kD; CELF-1; CUG-BP1; bruno-like 2; EDEN-BP homolog; bruno-like protein 2; CUG RNA-binding protein; deadenylation factor CUG-BP; RNA-binding protein BRUNOL-2; CUG-BP- and ETR-3-like factor 1; CUG triplet repeat RNA-binding protein 1; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; 50 kDa nuclear polyadenylated RNA-binding protein; nuclear polyadenylated RNA-binding protein, 50-kD; embryo deadenylation element-binding protein homolog; CUG-BP; CUGBP1; EDEN-BP;
Gene ID 10658
mRNA Refseq NM_001025596
Protein Refseq NP_001020767
MIM 601074
UniProt ID Q92879

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELF1 Products

Required fields are marked with *

My Review for All CELF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon