"CELSR2" Related Products

Expand

Recombinant Human CELSR2 protein, GST-tagged

Cat.No.: CELSR2-18H
Product Overview: Recombinant Human CELSR2(124 a.a. - 233 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.84 kDa
AA Sequence: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CELSR2 cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila) [ Homo sapiens ]
Official Symbol: CELSR2
Synonyms: CELSR2; cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila); cadherin, EGF LAG seven pass G type receptor 2, flamingo (Drosophila) homolog , EGFL2; cadherin EGF LAG seven-pass G-type receptor 2; CDHF10; Flamingo1; KIAA0279; MEGF3; EGF-like protein 2; flamingo homolog 3; cadherin family member 10; EGF-like-domain, multiple 2; epidermal growth factor-like 2; multiple EGF-like domains protein 3; epidermal growth factor-like protein 2; multiple epidermal growth factor-like domains 3; multiple epidermal growth factor-like domains protein 3; EGFL2; FLJ34118; FLJ42737; FLJ45143; FLJ45845;
Gene ID: 1952
mRNA Refseq: NM_001408
Protein Refseq: NP_001399
MIM: 604265
UniProt ID: Q9HCU4
Chromosome Location: 1p13.3
Pathway: GPCRs, Other, organism-specific biosystem;
Function: G-protein coupled receptor activity; binding; calcium ion binding; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.