Recombinant Human CELSR2 protein, GST-tagged

Cat.No. : CELSR2-18H
Product Overview : Recombinant Human CELSR2(124 a.a. - 233 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 124-233 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CELSR2 cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila) [ Homo sapiens ]
Official Symbol CELSR2
Synonyms CELSR2; cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila); cadherin, EGF LAG seven pass G type receptor 2, flamingo (Drosophila) homolog , EGFL2; cadherin EGF LAG seven-pass G-type receptor 2; CDHF10; Flamingo1; KIAA0279; MEGF3; EGF-like protein 2; flamingo homolog 3; cadherin family member 10; EGF-like-domain, multiple 2; epidermal growth factor-like 2; multiple EGF-like domains protein 3; epidermal growth factor-like protein 2; multiple epidermal growth factor-like domains 3; multiple epidermal growth factor-like domains protein 3; EGFL2; FLJ34118; FLJ42737; FLJ45143; FLJ45845;
Gene ID 1952
mRNA Refseq NM_001408
Protein Refseq NP_001399
MIM 604265
UniProt ID Q9HCU4
Chromosome Location 1p13.3
Pathway GPCRs, Other, organism-specific biosystem;
Function G-protein coupled receptor activity; binding; calcium ion binding; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELSR2 Products

Required fields are marked with *

My Review for All CELSR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon