Recombinant Human CENPF Protein, GST-Tagged
| Cat.No. : | CENPF-1115H | 
| Product Overview : | Human CENPF partial ORF (NP_057427, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a protein that associates with the centromere-kinetochore complex. The protein is a component of the nuclear matrix during the G2 phase of interphase. In late G2 the protein associates with the kinetochore and maintains this association through early anaphase. It localizes to the spindle midzone and the intracellular bridge in late anaphase and telophase, respectively, and is thought to be subsequently degraded. The localization of this protein suggests that it may play a role in chromosome segregation during mitotis. It is thought to form either a homodimer or heterodimer. Autoantibodies against this protein have been found in patients with cancer or graft versus host disease. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 36.74 kDa | 
| AA Sequence : | CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKRLEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQ | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CENPF centromere protein F, 350/400kDa (mitosin) [ Homo sapiens ] | 
| Official Symbol | CENPF | 
| Synonyms | CENPF; centromere protein F, 350/400kDa (mitosin); centromere protein F (350/400kD, mitosin); centromere protein F; hcp 1; mitosin; AH antigen; kinetochore protein CENPF; CENP-F kinetochore protein; cell-cycle-dependent 350K nuclear protein; centromere protein F, 350/400ka (mitosin); CENF; hcp-1; PRO1779; | 
| Gene ID | 1063 | 
| mRNA Refseq | NM_016343 | 
| Protein Refseq | NP_057427 | 
| MIM | 600236 | 
| UniProt ID | P49454 | 
| ◆ Recombinant Proteins | ||
| CENPF-6213C | Recombinant Chicken CENPF | +Inquiry | 
| CENPF-486H | Recombinant Human CENPF Protein, His-tagged | +Inquiry | 
| CENPF-2743H | Recombinant Human CENPF Protein (1759-2093 aa), His-MBP-tagged | +Inquiry | 
| CENPF-011H | Recombinant Human centromere protein F Protein, His tagged | +Inquiry | 
| CENPF-1115H | Recombinant Human CENPF Protein, GST-Tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPF Products
Required fields are marked with *
My Review for All CENPF Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            