Recombinant Human CENPF Protein, GST-Tagged

Cat.No. : CENPF-1115H
Product Overview : Human CENPF partial ORF (NP_057427, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that associates with the centromere-kinetochore complex. The protein is a component of the nuclear matrix during the G2 phase of interphase. In late G2 the protein associates with the kinetochore and maintains this association through early anaphase. It localizes to the spindle midzone and the intracellular bridge in late anaphase and telophase, respectively, and is thought to be subsequently degraded. The localization of this protein suggests that it may play a role in chromosome segregation during mitotis. It is thought to form either a homodimer or heterodimer. Autoantibodies against this protein have been found in patients with cancer or graft versus host disease. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKRLEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CENPF centromere protein F, 350/400kDa (mitosin) [ Homo sapiens ]
Official Symbol CENPF
Synonyms CENPF; centromere protein F, 350/400kDa (mitosin); centromere protein F (350/400kD, mitosin); centromere protein F; hcp 1; mitosin; AH antigen; kinetochore protein CENPF; CENP-F kinetochore protein; cell-cycle-dependent 350K nuclear protein; centromere protein F, 350/400ka (mitosin); CENF; hcp-1; PRO1779;
Gene ID 1063
mRNA Refseq NM_016343
Protein Refseq NP_057427
MIM 600236
UniProt ID P49454

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CENPF Products

Required fields are marked with *

My Review for All CENPF Products

Required fields are marked with *

0
cart-icon