Recombinant Human CENPP Protein, GST-Tagged
| Cat.No. : | CENPP-1124H |
| Product Overview : | Human CENPP full-length ORF (NP_001012267.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 59.6 kDa |
| AA Sequence : | MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CENPP centromere protein P [ Homo sapiens ] |
| Official Symbol | CENPP |
| Synonyms | CENPP; centromere protein P; CENP P; RP11 19J3.3; CENP-P; RP11-19J3.3; FLJ33928; |
| Gene ID | 401541 |
| mRNA Refseq | NM_001012267 |
| Protein Refseq | NP_001012267 |
| MIM | 611505 |
| UniProt ID | Q6IPU0 |
| ◆ Recombinant Proteins | ||
| CENPP-1124H | Recombinant Human CENPP Protein, GST-Tagged | +Inquiry |
| CENPP-640R | Recombinant Rhesus Macaque CENPP Protein, His (Fc)-Avi-tagged | +Inquiry |
| CENPP-6156H | Recombinant Human CENPP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CENPP-3427C | Recombinant Chicken CENPP | +Inquiry |
| CENPP-814R | Recombinant Rhesus monkey CENPP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CENPP-7577HCL | Recombinant Human CENPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPP Products
Required fields are marked with *
My Review for All CENPP Products
Required fields are marked with *
