Recombinant Human CEP126 Protein (559-670 aa), His-SUMO-tagged

• Cat.No.: CEP126-1712H
• Product Overview: Recombinant Human CEP126 Protein (559-670 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His&SUMO
• Protein Length: 559-670 aa
• Description: Participates in cytokinesis . Necessary for microtubules and mitotic spindle organization . Involved in primary cilium formation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.9 kDa
• AA Sequence: HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: CEP126 centrosomal protein 126 [ Homo sapiens (human) ]
• Official Symbol: CEP126
• Synonyms: KIAA1377
• Gene ID: 57562
• mRNA Refseq: NM_020802
• Protein Refseq: NP_065853
• UniProt ID: Q9P2H0