Recombinant Human CEP135 protein, GST-tagged
| Cat.No. : | CEP135-1223H | 
| Product Overview : | Recombinant Human CEP135 protein(1-233 aa), fused to GST tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-233 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. | 
| AA Sequence : | MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFDFVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAMMESGVRDYSKQ | 
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | CEP135 centrosomal protein 135kDa [ Homo sapiens ] | 
| Official Symbol | CEP135 | 
| Synonyms | CEP135; centrosomal protein 135kDa; centrosomal protein 4 , CEP4, KIAA0635; centrosomal protein of 135 kDa; FLJ13621; centrosomal protein 4; centrosome protein cep135; CEP4; KIAA0635; | 
| Gene ID | 9662 | 
| mRNA Refseq | NM_025009 | 
| Protein Refseq | NP_079285 | 
| MIM | 611423 | 
| UniProt ID | Q66GS9 | 
| ◆ Recombinant Proteins | ||
| CEP135-7897Z | Recombinant Zebrafish CEP135 | +Inquiry | 
| CEP135-1587M | Recombinant Mouse CEP135 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CEP135-3299M | Recombinant Mouse CEP135 Protein | +Inquiry | 
| CEP135-3747H | Recombinant Human CEP135 protein, His-tagged | +Inquiry | 
| CEP135-1223H | Recombinant Human CEP135 protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEP135 Products
Required fields are marked with *
My Review for All CEP135 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            