Recombinant Human CEP135 protein, His-tagged
Cat.No. : | CEP135-3747H |
Product Overview : | Recombinant Human CEP135 protein(1-233 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-233 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFDFVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAMMESGVRDYSKQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CEP135 centrosomal protein 135kDa [ Homo sapiens ] |
Official Symbol | CEP135 |
Synonyms | CEP135; centrosomal protein 135kDa; centrosomal protein 4 , CEP4, KIAA0635; centrosomal protein of 135 kDa; FLJ13621; centrosomal protein 4; centrosome protein cep135; CEP4; KIAA0635; |
Gene ID | 9662 |
mRNA Refseq | NM_025009 |
Protein Refseq | NP_079285 |
MIM | 611423 |
UniProt ID | Q66GS9 |
◆ Recombinant Proteins | ||
CEP135-1587M | Recombinant Mouse CEP135 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEP135-3747H | Recombinant Human CEP135 protein, His-tagged | +Inquiry |
CEP135-1223H | Recombinant Human CEP135 protein, GST-tagged | +Inquiry |
CEP135-7897Z | Recombinant Zebrafish CEP135 | +Inquiry |
CEP135-3299M | Recombinant Mouse CEP135 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEP135 Products
Required fields are marked with *
My Review for All CEP135 Products
Required fields are marked with *
0
Inquiry Basket