Recombinant Human CERS4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CERS4-4824H
Product Overview : LASS4 MS Standard C13 and N15-labeled recombinant protein (NP_078828) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CERS4 (Ceramide Synthase 4) is a Protein Coding gene. Diseases associated with CERS4 include Fetal Akinesia Deformation Sequence 1. Among its related pathways are Sphingolipid signaling pathway and Sphingolipid metabolism. Gene Ontology (GO) annotations related to this gene include sphingosine N-acyltransferase activity. An important paralog of this gene is CERS2.
Molecular Mass : 46.4 kDa
AA Sequence : MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEVAAAQEPLQLKNGAAGGPRPAPTDGPQSRVAGRLTNRHTTATTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CERS4 ceramide synthase 4 [ Homo sapiens (human) ]
Official Symbol CERS4
Synonyms CERS4; ceramide synthase 4; LAG1 homolog, ceramide synthase 4, LAG1 longevity assurance homolog 4 (S. cerevisiae), LASS4; FLJ12089; Trh1; LAG1 homolog, ceramide synthase 4; LAG1 longevity assurance homolog 4; LASS4;
Gene ID 79603
mRNA Refseq NM_024552
Protein Refseq NP_078828
MIM 615334
UniProt ID Q9HA82

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CERS4 Products

Required fields are marked with *

My Review for All CERS4 Products

Required fields are marked with *

0
cart-icon