Recombinant Human CETN2 protein, His-SUMO-tagged
Cat.No. : | CETN2-2688H |
Product Overview : | Recombinant Human CETN2 protein(P41208)(1-172aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-172aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ] |
Official Symbol | CETN2 |
Synonyms | CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; caltractin (20kD calcium-binding protein); |
Gene ID | 1069 |
mRNA Refseq | NM_004344 |
Protein Refseq | NP_004335 |
MIM | 300006 |
UniProt ID | P41208 |
◆ Recombinant Proteins | ||
CETN2-27957TH | Recombinant Human CETN2, His-tagged | +Inquiry |
CETN2-0993H | Recombinant Human CETN2 Protein (Met1-Leu171), N-His tagged | +Inquiry |
CETN2-5019C | Recombinant Chicken CETN2 | +Inquiry |
CETN2-2235H | Recombinant Human CETN2 protein, His-tagged | +Inquiry |
CETN2-639H | Recombinant Human CETN2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CETN2 Products
Required fields are marked with *
My Review for All CETN2 Products
Required fields are marked with *
0
Inquiry Basket