Recombinant Human CETN2 protein, His-SUMO-tagged
| Cat.No. : | CETN2-2688H |
| Product Overview : | Recombinant Human CETN2 protein(P41208)(1-172aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-172aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.7 kDa |
| AA Sequence : | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ] |
| Official Symbol | CETN2 |
| Synonyms | CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; caltractin (20kD calcium-binding protein); |
| Gene ID | 1069 |
| mRNA Refseq | NM_004344 |
| Protein Refseq | NP_004335 |
| MIM | 300006 |
| UniProt ID | P41208 |
| ◆ Recombinant Proteins | ||
| CETN2-2235H | Recombinant Human CETN2 protein, His-tagged | +Inquiry |
| CETN2-3289HF | Recombinant Full Length Human CETN2 Protein, GST-tagged | +Inquiry |
| CETN2-5019C | Recombinant Chicken CETN2 | +Inquiry |
| CETN2-3339M | Recombinant Mouse CETN2 Protein | +Inquiry |
| CETN2-650R | Recombinant Rhesus Macaque CETN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CETN2 Products
Required fields are marked with *
My Review for All CETN2 Products
Required fields are marked with *
