Recombinant Human CFAP20 Protein (1-193 aa), GST-tagged

• Cat.No.: CFAP20-2133H
• Product Overview: Recombinant Human CFAP20 Protein (1-193 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-193 aa
• Description: Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 49.8 kDa
• AA Sequence: MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CFAP20 cilia and flagella associated protein 20 [ Homo sapiens (human) ]
• Official Symbol: CFAP20
• Synonyms: GTL3; BUG22; EVORF; fSAP23; C16orf80
• Gene ID: 29105
• mRNA Refseq: NM_013242
• Protein Refseq: NP_037374
• UniProt ID: Q9Y6A4