Recombinant Human CFAP20 Protein (1-193 aa), GST-tagged
| Cat.No. : | CFAP20-2133H |
| Product Overview : | Recombinant Human CFAP20 Protein (1-193 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-193 aa |
| Description : | Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 49.8 kDa |
| AA Sequence : | MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | CFAP20 cilia and flagella associated protein 20 [ Homo sapiens (human) ] |
| Official Symbol | CFAP20 |
| Synonyms | GTL3; BUG22; EVORF; fSAP23; C16orf80; |
| Gene ID | 29105 |
| mRNA Refseq | NM_013242 |
| Protein Refseq | NP_037374 |
| UniProt ID | Q9Y6A4 |
| ◆ Recombinant Proteins | ||
| CFAP20-2133H | Recombinant Human CFAP20 Protein (1-193 aa), GST-tagged | +Inquiry |
| CFAP20-11067Z | Recombinant Zebrafish CFAP20 | +Inquiry |
| Cfap20-1073M | Recombinant Mouse Cfap20 Protein, MYC/DDK-tagged | +Inquiry |
| CFAP20-1084H | Recombinant Human CFAP20 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CFAP20-3197H | Recombinant Human CFAP20 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFAP20-85HCL | Recombinant Human CFAP20 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFAP20 Products
Required fields are marked with *
My Review for All CFAP20 Products
Required fields are marked with *
