Recombinant Human CFAP20 Protein (1-193 aa), GST-tagged

Cat.No. : CFAP20-2133H
Product Overview : Recombinant Human CFAP20 Protein (1-193 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-193 aa
Description : Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 49.8 kDa
AA Sequence : MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name CFAP20 cilia and flagella associated protein 20 [ Homo sapiens (human) ]
Official Symbol CFAP20
Synonyms GTL3; BUG22; EVORF; fSAP23; C16orf80;
Gene ID 29105
mRNA Refseq NM_013242
Protein Refseq NP_037374
UniProt ID Q9Y6A4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFAP20 Products

Required fields are marked with *

My Review for All CFAP20 Products

Required fields are marked with *

0
cart-icon
0
compare icon