Recombinant Human CFAP20 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CFAP20-1084H |
Product Overview : | C16orf80 MS Standard C13 and N15-labeled recombinant protein (NP_037374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CFAP20 (Cilia And Flagella Associated Protein 20) is a Protein Coding gene. Diseases associated with CFAP20 include Familial Atrial Fibrillation. An important paralog of this gene is CFAP20DC. |
Molecular Mass : | 22.8 kDa |
AA Sequence : | MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CFAP20 cilia and flagella associated protein 20 [ Homo sapiens (human) ] |
Official Symbol | CFAP20 |
Synonyms | CFAP20; cilia and flagella associated protein 20; GTL3; BUG22; EVORF; fSAP23; C16orf80; cilia- and flagella-associated protein 20; UPF0468 protein C16orf80; basal body up-regulated protein 22; flagellar associated protein 20 homolog; functional spliceosome-associated protein 23; gene trap locus 3; transcription factor IIB |
Gene ID | 29105 |
mRNA Refseq | NM_013242 |
Protein Refseq | NP_037374 |
MIM | 617906 |
UniProt ID | Q9Y6A4 |
◆ Recombinant Proteins | ||
Cfap20-1073M | Recombinant Mouse Cfap20 Protein, MYC/DDK-tagged | +Inquiry |
CFAP20-1084H | Recombinant Human CFAP20 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CFAP20-2133H | Recombinant Human CFAP20 Protein (1-193 aa), GST-tagged | +Inquiry |
CFAP20-11067Z | Recombinant Zebrafish CFAP20 | +Inquiry |
CFAP20-3197H | Recombinant Human CFAP20 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFAP20-85HCL | Recombinant Human CFAP20 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFAP20 Products
Required fields are marked with *
My Review for All CFAP20 Products
Required fields are marked with *