Recombinant Human CFH Protein, GST-Tagged
Cat.No. : | CFH-1168H |
Product Overview : | Human CFH full-length ORF (AAH37285, 20 a.a. - 449 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Oct 2011] |
Molecular Mass : | 73.04 kDa |
AA Sequence : | DCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFH complement factor H [ Homo sapiens ] |
Official Symbol | CFH |
Synonyms | CFH; complement factor H; H factor 1 (complement), HF, HF1, HF2; age related maculopathy susceptibility 1; ARMS1; beta 1H; FHL1; H factor 2 (complement); HUS; beta-1H; factor H; factor H-like 1; beta-1-H-globulin; H factor 1 (complement); adrenomedullin binding protein; complement factor H, isoform b; age-related maculopathy susceptibility 1; FH; HF; HF1; HF2; AHUS1; AMBP1; ARMD4; CFHL3; MGC88246; |
Gene ID | 3075 |
mRNA Refseq | NM_000186 |
Protein Refseq | NP_000177 |
MIM | 134370 |
UniProt ID | P08603 |
◆ Recombinant Proteins | ||
Cfh-761M | Recombinant Mouse Cfh protein, His-GST-tagged | +Inquiry |
CFH-1048H | Recombinant Human CFH Protein (Glu19-Pro346), N-His tagged | +Inquiry |
CFH-641H | Recombinant Human CFH protein, His-tagged | +Inquiry |
CFH-762H | Recombinant Human CFH Protein, His-tagged | +Inquiry |
CFH-3184H | Recombinant Human CFH Full Length Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CFH-23H | Active Native Human Complement factor H | +Inquiry |
CFH-115H | Active Native Human Factor H | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFH-2409HCL | Recombinant Human CFH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFH Products
Required fields are marked with *
My Review for All CFH Products
Required fields are marked with *
0
Inquiry Basket