Recombinant Human CFHR5, GST-tagged

Cat.No. : CFHR5-922H
Product Overview : Recombinant Human CFHR5 fused with GST-tag at N-terminal, was expressed in vitro wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : A mutation in CHFR5 was found in patients with the disease CFHR5 nephropathy, which is a common cause of renal disease in Cyprus. The mutated form of the protein found in patients with this disease has impaired ability to bind to complement C3, suggesting that CFHR5 is important in protecting the kidneys from attack by the complement system.
MolecularMass : 90.8 kDa
Sequence : MLLLFSVILISWVSTVGGEGTLCDFPKIHHGFLYDEEDYNPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSP TPKCLRMCSFPFVKNGHSESSGLIHLEGDTVQIICNTGYSLQNNEKNISCVERGWSTPPICSFTKGECHVPILEANVD AQPKKESYKVGDVLKFSCRKNLIRVGSDSVQCYQFGWSPNFPTCKGQVRSCGPPPQLSNGEVKEIRKEEYGHNEVV EYDCNPNFIINGPKKIQCVDGEWTTLPTCVEQVKTCGYIPELEYGYVQPSVPPYQHGVSVEVNCRNEYAMIGNNMITCIN GIWTELPMCVATHQLKRCKIAGVNIKTLLKLSGKEFNHNSRIRYRCSDIFRYRHSVCINGKWNPEVDCTEKREQFCPPP PQIPNAQNMTTTVNYQDGEKVAVLCKENYLLPEAKEIVCKDGRWQSLPRCVESTAYCGPPPSINNGDTTSFPLSVYPPG STVTYRCQSFYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKNNIQLKWRNDGKLYAKTGDAVEFQCKFPHKA MISSPPFRAICQEGKFEYPICE
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note : Best use within three months from the date of receipt of this protein.
OfficialSymbol : CFHR5
Gene Name CFHR5 complement factor H-related 5 [ Homo sapiens ]
Synonyms FHR5; CFHL5; FHR-5; complement factor H-related protein 5; factor H-related protein 5; complement factor H-related 5
Gene ID 81494
mRNA Refseq NM_030787
Protein Refseq NP_110414
MIM 608593
UniProt ID Q9BXR6
Chromosome Location 1q31.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFHR5 Products

Required fields are marked with *

My Review for All CFHR5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon