Recombinant Human CFHR5, GST-tagged
Cat.No. : | CFHR5-922H |
Product Overview : | Recombinant Human CFHR5 fused with GST-tag at N-terminal, was expressed in vitro wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | A mutation in CHFR5 was found in patients with the disease CFHR5 nephropathy, which is a common cause of renal disease in Cyprus. The mutated form of the protein found in patients with this disease has impaired ability to bind to complement C3, suggesting that CFHR5 is important in protecting the kidneys from attack by the complement system. |
MolecularMass : | 90.8 kDa |
Sequence : | MLLLFSVILISWVSTVGGEGTLCDFPKIHHGFLYDEEDYNPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSP TPKCLRMCSFPFVKNGHSESSGLIHLEGDTVQIICNTGYSLQNNEKNISCVERGWSTPPICSFTKGECHVPILEANVD AQPKKESYKVGDVLKFSCRKNLIRVGSDSVQCYQFGWSPNFPTCKGQVRSCGPPPQLSNGEVKEIRKEEYGHNEVV EYDCNPNFIINGPKKIQCVDGEWTTLPTCVEQVKTCGYIPELEYGYVQPSVPPYQHGVSVEVNCRNEYAMIGNNMITCIN GIWTELPMCVATHQLKRCKIAGVNIKTLLKLSGKEFNHNSRIRYRCSDIFRYRHSVCINGKWNPEVDCTEKREQFCPPP PQIPNAQNMTTTVNYQDGEKVAVLCKENYLLPEAKEIVCKDGRWQSLPRCVESTAYCGPPPSINNGDTTSFPLSVYPPG STVTYRCQSFYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKNNIQLKWRNDGKLYAKTGDAVEFQCKFPHKA MISSPPFRAICQEGKFEYPICE |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note : | Best use within three months from the date of receipt of this protein. |
OfficialSymbol : | CFHR5 |
Gene Name | CFHR5 complement factor H-related 5 [ Homo sapiens ] |
Synonyms | FHR5; CFHL5; FHR-5; complement factor H-related protein 5; factor H-related protein 5; complement factor H-related 5 |
Gene ID | 81494 |
mRNA Refseq | NM_030787 |
Protein Refseq | NP_110414 |
MIM | 608593 |
UniProt ID | Q9BXR6 |
Chromosome Location | 1q31.3 |
◆ Recombinant Proteins | ||
CFHR5-2663H | Recombinant Human CFHR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFHR5-3211H | Recombinant Human CFHR5 Protein, MYC/DDK-tagged | +Inquiry |
CFHR5-3875HF | Recombinant Full Length Human CFHR5 Protein, GST-tagged | +Inquiry |
CFHR5-153H | Recombinant Human CFHR5 Protein, HIS-tagged | +Inquiry |
CFHR5-774H | Active Recombinant Human CFHR5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFHR5-340HCL | Recombinant Human CFHR5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFHR5 Products
Required fields are marked with *
My Review for All CFHR5 Products
Required fields are marked with *
0
Inquiry Basket