Recombinant Human CFL2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CFL2-6639H
• Product Overview: CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_619579) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 18.7 kDa
• AA Sequence: MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CFL2 cofilin 2 [ Homo sapiens (human) ]
• Official Symbol: CFL2
• Synonyms: CFL2; cofilin 2 (muscle); cofilin-2; cofilin, muscle isoform; NEM7
• Gene ID: 1073
• mRNA Refseq: NM_138638
• Protein Refseq: NP_619579
• MIM: 601443
• UniProt ID: Q9Y281