Recombinant Human CFL2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CFL2-6639H |
Product Overview : | CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_619579) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 18.7 kDa |
AA Sequence : | MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CFL2 cofilin 2 [ Homo sapiens (human) ] |
Official Symbol | CFL2 |
Synonyms | CFL2; cofilin 2 (muscle); cofilin-2; cofilin, muscle isoform; NEM7; |
Gene ID | 1073 |
mRNA Refseq | NM_138638 |
Protein Refseq | NP_619579 |
MIM | 601443 |
UniProt ID | Q9Y281 |
◆ Recombinant Proteins | ||
CFL2-2466HF | Active Recombinant Full Length Human CFL2 Protein, GST-tagged | +Inquiry |
CFL2-3351M | Recombinant Mouse CFL2 Protein | +Inquiry |
CFL2-6639H | Recombinant Human CFL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CFL2-26779TH | Recombinant Human CFL2 | +Inquiry |
CFL2-1003H | Recombinant Human CFL2 Protein (Met1-Asn156), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFL2-7554HCL | Recombinant Human CFL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFL2 Products
Required fields are marked with *
My Review for All CFL2 Products
Required fields are marked with *