Recombinant Human CGA Protein
| Cat.No. : | CGA-486H |
| Product Overview : | Recombinant human CGA protein |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Protein Length : | 116 |
| Description : | The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | Lyophilized |
| AA Sequence : | MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | CGA glycoprotein hormones, alpha polypeptide [ Homo sapiens (human) ] |
| Official Symbol | CGA |
| Synonyms | CGA; glycoprotein hormones, alpha polypeptide; glycoprotein hormones alpha chain; chorionic gonadotropin; alpha polypeptide; follicle stimulating hormone alpha subunit; FSHA; GPHa; GPHA1; HCG; LHA; luteinizing hormone alpha chain; lutropin alpha chain; thyroid stimulating hormone alpha chain; TSHA; FSH-alpha; LSH-alpha; TSH-alpha; follitropin alpha chain; thyrotropin alpha chain; choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; thyroid-stimulating hormone alpha chain; follicle-stimulating hormone alpha chain; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha subunit; anterior pituitary glycoprotein hormones common subunit alpha; CG-ALPHA; |
| Gene ID | 1081 |
| mRNA Refseq | NM_000735 |
| Protein Refseq | NP_000726 |
| MIM | 118850 |
| UniProt ID | P01215 |
| ◆ Recombinant Proteins | ||
| CGA-486H | Recombinant Human CGA Protein | +Inquiry |
| CGA-152C | Recombinant Cynomolgus Monkey CGA Protein, His (Fc)-Avi-tagged | +Inquiry |
| CGA-286H | Recombinant Human CGA protein, His-tagged | +Inquiry |
| CGA-285H | Recombinant Human CGA, Fc-tagged | +Inquiry |
| CGA-11710Z | Recombinant Zebrafish CGA | +Inquiry |
| ◆ Native Proteins | ||
| CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
| CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
| CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
| CGA-8356H | Native Human CGA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CGA-001HCL | Recombinant Human CGA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CGA Products
Required fields are marked with *
My Review for All CGA Products
Required fields are marked with *
