Recombinant Human CGGBP1 protein, GST-tagged
| Cat.No. : | CGGBP1-11148H |
| Product Overview : | Recombinant Human CGGBP1 protein(1-167 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-167 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CGGBP1 CGG triplet repeat binding protein 1 [ Homo sapiens ] |
| Official Symbol | CGGBP1 |
| Synonyms | CGGBP1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGGBP; p20 CGG binding protein; p20 CGGBP; CGG-binding protein 1; p20-CGG binding protein; 20 kDa CGG-binding protein; p20-CGGBP DNA-binding protein; p20-CGGBP; |
| Gene ID | 8545 |
| mRNA Refseq | NM_001008390 |
| Protein Refseq | NP_001008391 |
| MIM | 603363 |
| UniProt ID | Q9UFW8 |
| ◆ Recombinant Proteins | ||
| CGGBP1-405C | Recombinant Cynomolgus CGGBP1 Protein, His-tagged | +Inquiry |
| CGGBP1-153C | Recombinant Cynomolgus Monkey CGGBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CGGBP1-182H | Recombinant Human CGGBP1 protein, MYC/DDK-tagged | +Inquiry |
| CGGBP1-3303HF | Recombinant Full Length Human CGGBP1 Protein, GST-tagged | +Inquiry |
| CGGBP1-27243TH | Recombinant Human CGGBP1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CGGBP1-7551HCL | Recombinant Human CGGBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CGGBP1 Products
Required fields are marked with *
My Review for All CGGBP1 Products
Required fields are marked with *
