Recombinant Human CGGBP1, His-tagged

Cat.No. : CGGBP1-27243TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-167 of Human CGGBP1 with N terminal His tag, 24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-167 a.a.
Description : CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.
Conjugation : HIS
Tissue specificity : Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain.
Form : Lyophilised:Reconstitute with 102 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGK LFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQN VRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYE NENQLLNSQDC
Full Length : Full L.
Gene Name CGGBP1 CGG triplet repeat binding protein 1 [ Homo sapiens ]
Official Symbol CGGBP1
Synonyms CGGBP1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGGBP; p20 CGG binding protein; p20 CGGBP;
Gene ID 8545
mRNA Refseq NM_001008390
Protein Refseq NP_001008391
MIM 603363
Uniprot ID Q9UFW8
Chromosome Location 3p12-p11.1
Function DNA binding; double-stranded DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CGGBP1 Products

Required fields are marked with *

My Review for All CGGBP1 Products

Required fields are marked with *

0
cart-icon