Recombinant Human CGGBP1, His-tagged
Cat.No. : | CGGBP1-27243TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-167 of Human CGGBP1 with N terminal His tag, 24kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-167 a.a. |
Description : | CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain. |
Form : | Lyophilised:Reconstitute with 102 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGK LFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQN VRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYE NENQLLNSQDC |
Full Length : | Full L. |
Gene Name | CGGBP1 CGG triplet repeat binding protein 1 [ Homo sapiens ] |
Official Symbol | CGGBP1 |
Synonyms | CGGBP1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGGBP; p20 CGG binding protein; p20 CGGBP; |
Gene ID | 8545 |
mRNA Refseq | NM_001008390 |
Protein Refseq | NP_001008391 |
MIM | 603363 |
Uniprot ID | Q9UFW8 |
Chromosome Location | 3p12-p11.1 |
Function | DNA binding; double-stranded DNA binding; |
◆ Recombinant Proteins | ||
CGGBP1-3101H | Recombinant Human CGGBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CGGBP1-5317HFL | Recombinant Full Length Human CGGBP1 protein, Flag-tagged | +Inquiry |
CGGBP1-1493H | Recombinant Human CGGBP1 protein, MYC/DDK-tagged | +Inquiry |
Cggbp1-292M | Recombinant Mouse Cggbp1 Protein, MYC/DDK-tagged | +Inquiry |
CGGBP1-11148H | Recombinant Human CGGBP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CGGBP1-7551HCL | Recombinant Human CGGBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CGGBP1 Products
Required fields are marked with *
My Review for All CGGBP1 Products
Required fields are marked with *