Recombinant Human CGGBP1, His-tagged

• Cat.No.: CGGBP1-27243TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-167 of Human CGGBP1 with N terminal His tag, 24kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-167 a.a.
• Description: CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.
• Conjugation: HIS
• Tissue specificity: Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain.
• Form: Lyophilised:Reconstitute with 102 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGK LFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQN VRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYE NENQLLNSQDC
• Full Length: Full L.

Gene Information

• Gene Name: CGGBP1 CGG triplet repeat binding protein 1 [ Homo sapiens ]
• Official Symbol: CGGBP1
• Synonyms: CGGBP1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGGBP; p20 CGG binding protein; p20 CGGBP
• Gene ID: 8545
• mRNA Refseq: NM_001008390
• Protein Refseq: NP_001008391
• MIM: 603363
• Uniprot ID: Q9UFW8
• Chromosome Location: 3p12-p11.1
• Function: DNA binding; double-stranded DNA binding