Recombinant Human CGGBP1, His-tagged
| Cat.No. : | CGGBP1-27243TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-167 of Human CGGBP1 with N terminal His tag, 24kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-167 a.a. |
| Description : | CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR. |
| Conjugation : | HIS |
| Tissue specificity : | Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain. |
| Form : | Lyophilised:Reconstitute with 102 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGK LFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQN VRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYE NENQLLNSQDC |
| Full Length : | Full L. |
| Gene Name | CGGBP1 CGG triplet repeat binding protein 1 [ Homo sapiens ] |
| Official Symbol | CGGBP1 |
| Synonyms | CGGBP1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGGBP; p20 CGG binding protein; p20 CGGBP; |
| Gene ID | 8545 |
| mRNA Refseq | NM_001008390 |
| Protein Refseq | NP_001008391 |
| MIM | 603363 |
| Uniprot ID | Q9UFW8 |
| Chromosome Location | 3p12-p11.1 |
| Function | DNA binding; double-stranded DNA binding; |
| ◆ Recombinant Proteins | ||
| CGGBP1-11148H | Recombinant Human CGGBP1 protein, GST-tagged | +Inquiry |
| CGGBP1-4614H | Recombinant Human CGGBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CGGBP1-832R | Recombinant Rhesus monkey CGGBP1 Protein, His-tagged | +Inquiry |
| CGGBP1-1191H | Recombinant Human CGGBP1 Protein, GST-Tagged | +Inquiry |
| CGGBP1-405C | Recombinant Cynomolgus CGGBP1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CGGBP1-7551HCL | Recombinant Human CGGBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CGGBP1 Products
Required fields are marked with *
My Review for All CGGBP1 Products
Required fields are marked with *



