Recombinant Human CGGBP1 Protein, GST-Tagged
Cat.No. : | CGGBP1-1191H |
Product Overview : | Human CGGBP1 full-length ORF (NP_001008391.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.[supplied by OMIM, Mar 2008] |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CGGBP1 CGG triplet repeat binding protein 1 [ Homo sapiens ] |
Official Symbol | CGGBP1 |
Synonyms | CGGBP1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGGBP; p20 CGG binding protein; p20 CGGBP; CGG-binding protein 1; p20-CGG binding protein; 20 kDa CGG-binding protein; p20-CGGBP DNA-binding protein; p20-CGGBP; |
Gene ID | 8545 |
mRNA Refseq | NM_001008390 |
Protein Refseq | NP_001008391 |
MIM | 603363 |
UniProt ID | Q9UFW8 |
◆ Recombinant Proteins | ||
CGGBP1-1493H | Recombinant Human CGGBP1 protein, MYC/DDK-tagged | +Inquiry |
CGGBP1-658R | Recombinant Rhesus Macaque CGGBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CGGBP1-182H | Recombinant Human CGGBP1 protein, MYC/DDK-tagged | +Inquiry |
CGGBP1-832R | Recombinant Rhesus monkey CGGBP1 Protein, His-tagged | +Inquiry |
CGGBP1-3303HF | Recombinant Full Length Human CGGBP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CGGBP1-7551HCL | Recombinant Human CGGBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CGGBP1 Products
Required fields are marked with *
My Review for All CGGBP1 Products
Required fields are marked with *
0
Inquiry Basket