Recombinant Human CHAF1A Protein, GST-Tagged

Cat.No. : CHAF1A-1203H
Product Overview : Human CHAF1A partial ORF (AAH67093, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 2008]
Molecular Mass : 36.63 kDa
AA Sequence : CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHAF1A chromatin assembly factor 1, subunit A (p150) [ Homo sapiens ]
Official Symbol CHAF1A
Synonyms CHAF1A; chromatin assembly factor 1, subunit A (p150); chromatin assembly factor 1 subunit A; CAF 1; CAF1; CAF1B; CAF1P150; chromatin assembly factor I (150 kDa); MGC71229; P150; hp150; CAF-I p150; CAF-1 subunit A; CAF-I 150 kDa subunit; chromatin assembly factor I p150 subunit; CAF-1;
Gene ID 10036
mRNA Refseq NM_005483
Protein Refseq NP_005474
MIM 601246
UniProt ID Q13111

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHAF1A Products

Required fields are marked with *

My Review for All CHAF1A Products

Required fields are marked with *

0
cart-icon
0
compare icon