Recombinant Human CHAF1A Protein, GST-Tagged
Cat.No. : | CHAF1A-1203H |
Product Overview : | Human CHAF1A partial ORF (AAH67093, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHAF1A chromatin assembly factor 1, subunit A (p150) [ Homo sapiens ] |
Official Symbol | CHAF1A |
Synonyms | CHAF1A; chromatin assembly factor 1, subunit A (p150); chromatin assembly factor 1 subunit A; CAF 1; CAF1; CAF1B; CAF1P150; chromatin assembly factor I (150 kDa); MGC71229; P150; hp150; CAF-I p150; CAF-1 subunit A; CAF-I 150 kDa subunit; chromatin assembly factor I p150 subunit; CAF-1; |
Gene ID | 10036 |
mRNA Refseq | NM_005483 |
Protein Refseq | NP_005474 |
MIM | 601246 |
UniProt ID | Q13111 |
◆ Recombinant Proteins | ||
CHAF1A-1623M | Recombinant Mouse CHAF1A Protein, His (Fc)-Avi-tagged | +Inquiry |
Chaf1a-2136M | Recombinant Mouse Chaf1a Protein, Myc/DDK-tagged | +Inquiry |
CHAF1A-32H | Recombinant Human CHAF1A protein, MYC/DDK-tagged | +Inquiry |
CHAF1A-3365M | Recombinant Mouse CHAF1A Protein | +Inquiry |
CHAF1A-11157H | Recombinant Human CHAF1A, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHAF1A-7548HCL | Recombinant Human CHAF1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAF1A Products
Required fields are marked with *
My Review for All CHAF1A Products
Required fields are marked with *