Recombinant Human CHAT protein, GST-tagged CHAT-176H

Recombinant Human CHAT protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CHAT protein, GST-tagged

Recombinant Human CHAT protein, GST-tagged

CHAT Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CHAT-176H
Product Overview : Recombinant Human CHAT(1 a.a. - 630 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer disease. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 69.3 kDa
Protein length : 1 a.a. - 630 a.a.
AA Sequence : MAAKTPSSEESGLPKLPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANW VSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPL CMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNE DERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGA NRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELPAPRRLRWKCSPEIQG HLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVD NIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFM DETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDM RDLCSLLPPTESKPLATKEKATRPSQGHQP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : CHAT choline O-acetyltransferase [ Homo sapiens ]
Official Symbol : CHAT
Synonyms : CHAT; choline O-acetyltransferase; choline acetyltransferase; choline acetylase; acetyl CoA:choline O-acetyltransferase; CMS1A; CMS1A2; CHOACTASE;
Gene ID : 1103
mRNA Refseq : NM_020549
Protein Refseq : NP_065574
MIM : 118490
UniProt ID : P28329
Chromosome Location : 10q11.2
Pathway : Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Acetylcholine Synthesis, organism-specific biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Cholinergic synapse, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Neuronal System, organism-specific biosystem;
Function : choline O-acetyltransferase activity; choline binding; transferase activity, transferring acyl groups;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy