Recombinant Human CHD4

Cat.No. : CHD4-27065TH
Product Overview : Recombinant fragment of Human CHD4 protein with an N terminal proprietary tag; predicted MWt: 36.52 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Sequence Similarities : Belongs to the SNF2/RAD54 helicase family.Contains 2 chromo domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 2 PHD-type zinc fingers.
Gene Name CHD4 chromodomain helicase DNA binding protein 4 [ Homo sapiens ]
Official Symbol CHD4
Synonyms CHD4; chromodomain helicase DNA binding protein 4; chromodomain-helicase-DNA-binding protein 4; Mi 2b; Mi2 BETA;
Gene ID 1108
mRNA Refseq NM_001273
Protein Refseq NP_001264
MIM 603277
Uniprot ID Q14839
Chromosome Location 12p13
Pathway Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHD4 Products

Required fields are marked with *

My Review for All CHD4 Products

Required fields are marked with *

0
cart-icon