Recombinant Human CHD4 Protein (1-239 aa), His-tagged

Cat.No. : CHD4-1180H
Product Overview : Recombinant Human CHD4 Protein (1-239 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal and C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-239 aa
Description : Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.8 Kda
AA Sequence : MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name CHD4 chromodomain helicase DNA binding protein 4 [ Homo sapiens ]
Official Symbol CHD4
Synonyms CHD4; Mi 2b; Mi2 BETA; CHD-4; Mi-2b; Mi2-BETA; DKFZp686E06161;
Gene ID 1108
mRNA Refseq NM_001273
Protein Refseq NP_001264
MIM 603277
UniProt ID Q14839

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHD4 Products

Required fields are marked with *

My Review for All CHD4 Products

Required fields are marked with *

0
cart-icon