Recombinant Human CHD4 Protein (1-239 aa), His-tagged

• Cat.No.: CHD4-1180H
• Product Overview: Recombinant Human CHD4 Protein (1-239 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal and C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-239 aa
• Description: Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.8 Kda
• AA Sequence: MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CHD4 chromodomain helicase DNA binding protein 4 [ Homo sapiens ]
• Official Symbol: CHD4
• Synonyms: CHD4; Mi 2b; Mi2 BETA; CHD-4; Mi-2b; Mi2-BETA; DKFZp686E06161
• Gene ID: 1108
• mRNA Refseq: NM_001273
• Protein Refseq: NP_001264
• MIM: 603277
• UniProt ID: Q14839