Recombinant Human CHD4 Protein (1-239 aa), His-tagged
Cat.No. : | CHD4-1180H |
Product Overview : | Recombinant Human CHD4 Protein (1-239 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal and C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-239 aa |
Description : | Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.8 Kda |
AA Sequence : | MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | CHD4 chromodomain helicase DNA binding protein 4 [ Homo sapiens ] |
Official Symbol | CHD4 |
Synonyms | CHD4; Mi 2b; Mi2 BETA; CHD-4; Mi-2b; Mi2-BETA; DKFZp686E06161; |
Gene ID | 1108 |
mRNA Refseq | NM_001273 |
Protein Refseq | NP_001264 |
MIM | 603277 |
UniProt ID | Q14839 |
◆ Recombinant Proteins | ||
CHD4-1180H | Recombinant Human CHD4 Protein (1-239 aa), His-tagged | +Inquiry |
CHD4-1632M | Recombinant Mouse CHD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHD4-5153H | Recombinant Human CHD4 protein, His&His-tagged | +Inquiry |
CHD4-2434H | Recombinant Human CHD4 protein, His-tagged | +Inquiry |
CHD4-3379M | Recombinant Mouse CHD4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHD4-346HCL | Recombinant Human CHD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHD4 Products
Required fields are marked with *
My Review for All CHD4 Products
Required fields are marked with *
0
Inquiry Basket