Recombinant Human CHD9 Protein, GST-Tagged

• Cat.No.: CHD9-1218H
• Product Overview: Human CHD9 full-length ORF (AAH33770, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CHD9 (Chromodomain Helicase DNA Binding Protein 9) is a Protein Coding gene. Among its related pathways are Mitochondrial Gene Expression and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is CHD7.
• Molecular Mass: 38.83 kDa
• AA Sequence: MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHD9 chromodomain helicase DNA binding protein 9 [ Homo sapiens ]
• Official Symbol: CHD9
• Synonyms: CHD9; chromodomain helicase DNA binding protein 9; chromodomain-helicase-DNA-binding protein 9; BC022889; FLJ12178; KIAA0308; CHD-9; proteinx0008; kismet homolog 2; ATP-dependent helicase CHD9; ciprofibrate bound protein p240; chromatin remodeling factor CHROM1; chromatin-remodeling factor CHROM1; chromatin-related mesenchymal modulator; PPAR{gamma}-interacting cofactor 320 kDa; PPAR-alpha-interacting complex protein 320 kDa; peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein; AD013; CReMM; KISH2; PRIC320
• Gene ID: 80205
• mRNA Refseq: NM_025134
• Protein Refseq: NP_079410
• MIM: 616936
• UniProt ID: Q3L8U1