Recombinant Human CHL1 protein, His-tagged
| Cat.No. : | CHL1-3833H |
| Product Overview : | Recombinant Human CHL1 protein(737-1066 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 737-1066 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SMEQNGPGLEYRVTWKPQGAPVEWEEETVTNHTLRVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKDRVHGRLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDAFSEFHLTVLAYNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGKPITEESSTLGEGSKGIGKISGVNLTQKTHPVEVFEPGAEHIVRLMTKNWGDNDSIFQDVIETR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CHL1 cell adhesion molecule with homology to L1CAM (close homolog of L1) [ Homo sapiens ] |
| Official Symbol | CHL1 |
| Synonyms | CHL1; cell adhesion molecule with homology to L1CAM (close homolog of L1); cell adhesion molecule with homology to L1CAM (close homologue of L1); neural cell adhesion molecule L1-like protein; CALL; cell adhesion molecule L1 like; FLJ44930; L1CAM2; MGC132578; neural cell adhesion molecule; close homolog of L1; L1 cell adhesion molecule 2; FLJ30674; DKFZp547L174; |
| Gene ID | 10752 |
| mRNA Refseq | NM_001253387 |
| Protein Refseq | NP_001240316 |
| MIM | 607416 |
| UniProt ID | O00533 |
| ◆ Recombinant Proteins | ||
| CHL1-260M | Recombinant Mouse Chl1, His tagged | +Inquiry |
| CHL1-1703H | Recombinant Human CHL1 Protein (Pro35-Glu328), N-His tagged | +Inquiry |
| Chl1-455M | Active Recombinant Mouse Chl1, His-tagged | +Inquiry |
| CHL1-3145H | Recombinant Human CHL1 protein, His-tagged | +Inquiry |
| Chl1-1646M | Recombinant Mouse Chl1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHL1-001MCL | Recombinant Mouse CHL1 cell lysate | +Inquiry |
| CHL1-2202HCL | Recombinant Human CHL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHL1 Products
Required fields are marked with *
My Review for All CHL1 Products
Required fields are marked with *
