Recombinant Human CHMP2A Protein, GST-Tagged
Cat.No. : | CHMP2A-1249H |
Product Overview : | Human CHMP2A full-length ORF (NP_055268, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 50.05 kDa |
AA Sequence : | MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHMP2A charged multivesicular body protein 2A [ Homo sapiens ] |
Official Symbol | CHMP2A |
Synonyms | CHMP2A; charged multivesicular body protein 2A; chromatin modifying protein 2A; charged multivesicular body protein 2a; BC 2; CHMP2; putative breast adenocarcinoma marker (32kD); VPS2; VPS2 homolog A (S. cerevisiae); VPS2A; vps2-1; hVps2-1; VPS2 homolog A; chromatin-modifying protein 2a; putative breast adenocarcinoma marker BC-2; vacuolar protein sorting-associated protein 2-1; BC2; BC-2; |
Gene ID | 27243 |
mRNA Refseq | NM_014453 |
Protein Refseq | NP_055268 |
MIM | 610893 |
UniProt ID | O43633 |
◆ Recombinant Proteins | ||
CHMP2A-3405M | Recombinant Mouse CHMP2A Protein | +Inquiry |
CHMP2A-1650M | Recombinant Mouse CHMP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP2A-1396H | Recombinant Human Chromatin Modifying Protein 2A, His-tagged | +Inquiry |
CHMP2A-675R | Recombinant Rhesus Macaque CHMP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP2A-849R | Recombinant Rhesus monkey CHMP2A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP2A-7532HCL | Recombinant Human CHMP2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHMP2A Products
Required fields are marked with *
My Review for All CHMP2A Products
Required fields are marked with *
0
Inquiry Basket