Recombinant Human CHMP2A Protein, GST-Tagged
| Cat.No. : | CHMP2A-1249H |
| Product Overview : | Human CHMP2A full-length ORF (NP_055268, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 50.05 kDa |
| AA Sequence : | MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHMP2A charged multivesicular body protein 2A [ Homo sapiens ] |
| Official Symbol | CHMP2A |
| Synonyms | CHMP2A; charged multivesicular body protein 2A; chromatin modifying protein 2A; charged multivesicular body protein 2a; BC 2; CHMP2; putative breast adenocarcinoma marker (32kD); VPS2; VPS2 homolog A (S. cerevisiae); VPS2A; vps2-1; hVps2-1; VPS2 homolog A; chromatin-modifying protein 2a; putative breast adenocarcinoma marker BC-2; vacuolar protein sorting-associated protein 2-1; BC2; BC-2; |
| Gene ID | 27243 |
| mRNA Refseq | NM_014453 |
| Protein Refseq | NP_055268 |
| MIM | 610893 |
| UniProt ID | O43633 |
| ◆ Recombinant Proteins | ||
| CHMP2A-27958TH | Recombinant Human CHMP2A, His-tagged | +Inquiry |
| CHMP2A-3205HF | Recombinant Full Length Human CHMP2A Protein, GST-tagged | +Inquiry |
| CHMP2A-11184H | Recombinant Human CHMP2A, GST-tagged | +Inquiry |
| CHMP2A-4011H | Recombinant Human CHMP2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CHMP2A-849R | Recombinant Rhesus monkey CHMP2A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHMP2A-7532HCL | Recombinant Human CHMP2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP2A Products
Required fields are marked with *
My Review for All CHMP2A Products
Required fields are marked with *



