Recombinant Human CHMP4A Protein
| Cat.No. : | CHMP4A-1251H |
| Product Overview : | Human CHMP4A (NP_054888, 1 a.a.- 265 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | CHMP4A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
| Form : | Liquid |
| Molecular Mass : | 32 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Concentration : | 0.25 mg/mL |
| Storage Buffer : | In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM DTT, 50% glycerol, 0.1 mM PMSF, 1 mM EDTA) |
| Gene Name | CHMP4A charged multivesicular body protein 4A [ Homo sapiens ] |
| Official Symbol | CHMP4A |
| Synonyms | CHMP4A; charged multivesicular body protein 4A; C14orf123, chromatin modifying protein 4A, chromosome 14 open reading frame 123; charged multivesicular body protein 4a; HSPC134; VPS32A; chromatin modifying protein 4A; SNF7 homolog associated with Alix-2; Snf7 homologue associated with Alix 2; vacuolar protein sorting-associated protein 32-1; SNF7; CHMP4; SHAX2; CHMP4B; SNF7-1; VPS32-1; C14orf123; FLJ61658; MGC142093; MGC142095; |
| Gene ID | 29082 |
| mRNA Refseq | NM_014169 |
| Protein Refseq | NP_054888 |
| MIM | 610051 |
| UniProt ID | Q9BY43 |
| ◆ Recombinant Proteins | ||
| CHMP4A-1376H | Recombinant Human Charged Multivesicular Body Protein 4A, His-tagged | +Inquiry |
| CHMP4A-11186H | Recombinant Human CHMP4A, GST-tagged | +Inquiry |
| CHMP4A-1251H | Recombinant Human CHMP4A Protein | +Inquiry |
| CHMP4A-1252H | Recombinant Human CHMP4A Protein, GST-Tagged | +Inquiry |
| CHMP4A-3233H | Recombinant Human CHMP4A Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHMP4A-351HCL | Recombinant Human CHMP4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP4A Products
Required fields are marked with *
My Review for All CHMP4A Products
Required fields are marked with *
