Recombinant Human CHMP4A Protein

Cat.No. : CHMP4A-1251H
Product Overview : Human CHMP4A (NP_054888, 1 a.a.- 265 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : CHMP4A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
Form : Liquid
Molecular Mass : 32 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL
Storage Buffer : In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM DTT, 50% glycerol, 0.1 mM PMSF, 1 mM EDTA)
Gene Name CHMP4A charged multivesicular body protein 4A [ Homo sapiens ]
Official Symbol CHMP4A
Synonyms CHMP4A; charged multivesicular body protein 4A; C14orf123, chromatin modifying protein 4A, chromosome 14 open reading frame 123; charged multivesicular body protein 4a; HSPC134; VPS32A; chromatin modifying protein 4A; SNF7 homolog associated with Alix-2; Snf7 homologue associated with Alix 2; vacuolar protein sorting-associated protein 32-1; SNF7; CHMP4; SHAX2; CHMP4B; SNF7-1; VPS32-1; C14orf123; FLJ61658; MGC142093; MGC142095;
Gene ID 29082
mRNA Refseq NM_014169
Protein Refseq NP_054888
MIM 610051
UniProt ID Q9BY43

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHMP4A Products

Required fields are marked with *

My Review for All CHMP4A Products

Required fields are marked with *

0
cart-icon