Recombinant Human CHMP5 Protein, GST-Tagged

Cat.No. : CHMP5-1253H
Product Overview : Human CHMP5 full-length ORF (NP_057494.2, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
Molecular Mass : 50.9 kDa
AA Sequence : MNRLFGKAKPKAPPPSLTGCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHMP5 charged multivesicular body protein 5 [ Homo sapiens ]
Official Symbol CHMP5
Synonyms CHMP5; charged multivesicular body protein 5; C9orf83, chromatin modifying protein 5, chromosome 9 open reading frame 83, SNF7DC2; CGI 34; HSPC177; Vps60; hVps60; SNF7 domain containing 2; chromatin modifying protein 5; chromatin-modifying protein 5; SNF7 domain-containing protein 2; apoptosis-related protein PNAS-2; vacuolar protein sorting-associated protein 60; CGI-34; PNAS-2; C9orf83; SNF7DC2;
Gene ID 51510
mRNA Refseq NM_001195536
Protein Refseq NP_001182465
MIM 610900
UniProt ID Q9NZZ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHMP5 Products

Required fields are marked with *

My Review for All CHMP5 Products

Required fields are marked with *

0
cart-icon
0
compare icon