Recombinant Human CHRM2 protein, His-tagged

• Cat.No.: CHRM2-322H
• Product Overview: Recombinant Human CHRM2 protein(P08172)(210-387aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 210-387aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTR

Gene Information

• Gene Name: CHRM2 cholinergic receptor, muscarinic 2 [ Homo sapiens ]
• Official Symbol: CHRM2
• Synonyms: CHRM2; cholinergic receptor, muscarinic 2; muscarinic acetylcholine receptor M2; acetylcholine receptor; muscarinic 2; 7TM receptor; muscarinic M2 receptor; acetylcholine receptor, muscarinic 2; cholinergic receptor, muscarinic 2, isoform a; HM2; FLJ43243; MGC120006; MGC120007
• Gene ID: 1129
• mRNA Refseq: NM_000739
• Protein Refseq: NP_000730
• MIM: 118493
• UniProt ID: P08172