Recombinant Human CHRM2 protein, His-tagged
Cat.No. : | CHRM2-322H |
Product Overview : | Recombinant Human CHRM2 protein(P08172)(210-387aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 210-387aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTR |
Gene Name | CHRM2 cholinergic receptor, muscarinic 2 [ Homo sapiens ] |
Official Symbol | CHRM2 |
Synonyms | CHRM2; cholinergic receptor, muscarinic 2; muscarinic acetylcholine receptor M2; acetylcholine receptor; muscarinic 2; 7TM receptor; muscarinic M2 receptor; acetylcholine receptor, muscarinic 2; cholinergic receptor, muscarinic 2, isoform a; HM2; FLJ43243; MGC120006; MGC120007; |
Gene ID | 1129 |
mRNA Refseq | NM_000739 |
Protein Refseq | NP_000730 |
MIM | 118493 |
UniProt ID | P08172 |
◆ Recombinant Proteins | ||
CHRM2-322H | Recombinant Human CHRM2 protein, His-tagged | +Inquiry |
CHRM2-1044R | Recombinant Rat CHRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20261MF | Recombinant Full Length Mouse Muscarinic Acetylcholine Receptor M2(Chrm2) Protein, His-Tagged | +Inquiry |
CHRM2-1386R | Recombinant Rat CHRM2 Protein | +Inquiry |
CHRM2-1094HFL | Recombinant Human CHRM2 protein, His&Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRM2-7520HCL | Recombinant Human CHRM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRM2 Products
Required fields are marked with *
My Review for All CHRM2 Products
Required fields are marked with *
0
Inquiry Basket