Recombinant Human CHRM3 Protein, GST-Tagged
Cat.No. : | CHRM3-1273H |
Product Overview : | Human CHRM3 partial ORF (NP_000731, 1 a.a. - 67 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016] |
Molecular Mass : | 33.11 kDa |
AA Sequence : | MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRM3 cholinergic receptor, muscarinic 3 [ Homo sapiens ] |
Official Symbol | CHRM3 |
Synonyms | CHRM3; cholinergic receptor, muscarinic 3; muscarinic acetylcholine receptor M3; acetylcholine receptor; muscarinic 3; m3 muscarinic receptor; acetylcholine receptor, muscarinic 3; HM3; EGBRS; |
Gene ID | 1131 |
mRNA Refseq | NM_000740 |
Protein Refseq | NP_000731 |
MIM | 118494 |
UniProt ID | P20309 |
◆ Recombinant Proteins | ||
CHRM3-860R | Recombinant Rhesus monkey CHRM3 Protein, His-tagged | +Inquiry |
CHRM3-1095HFL | Recombinant Human CHRM3 protein, His&Flag-tagged | +Inquiry |
CHRM3-1362H | Recombinant Human CHRM3 Protein (253-492 aa), His-tagged | +Inquiry |
CHRM3-686R | Recombinant Rhesus Macaque CHRM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2114SF | Recombinant Full Length Pig Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRM3-7519HCL | Recombinant Human CHRM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRM3 Products
Required fields are marked with *
My Review for All CHRM3 Products
Required fields are marked with *
0
Inquiry Basket