Recombinant Human CHRNA1 protein, His-Trx-tagged
Cat.No. : | CHRNA1-2695H |
Product Overview : | Recombinant Human CHRNA1 protein(P02708)(21-255aa), fused to N-terminal His tag and Trx tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Trx |
Protein Length : | 21-255aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.1 kDa |
AA Sequence : | SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CHRNA1 cholinergic receptor, nicotinic, alpha 1 (muscle) [ Homo sapiens ] |
Official Symbol | CHRNA1 |
Synonyms | CHRNA1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) , CHRNA; acetylcholine receptor subunit alpha; acetylcholine receptor; nicotinic; alpha 1 (muscle); nicotinic cholinergic receptor alpha 1; muscle nicotinic acetylcholine receptor; nicotinic acetylcholine receptor alpha subunit; acetylcholine receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle); ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS; |
Gene ID | 1134 |
mRNA Refseq | NM_000079 |
Protein Refseq | NP_000070 |
MIM | 100690 |
UniProt ID | P02708 |
◆ Recombinant Proteins | ||
Chrna1-2696M | Recombinant Mouse Chrna1 protein, His-tagged | +Inquiry |
CHRNA1-1721H | Recombinant Human CHRNA1 Protein (Pro256-Ile341), N-GST tagged | +Inquiry |
CHRNA1-292P | Recombinant Pacific electric ray CHRNA1 protein(25-234aa) | +Inquiry |
CHRNA1-406M | Recombinant Mouse CHRNA1 Protein (21-230 aa), His-SUMO-tagged | +Inquiry |
CHRNA1-3225HF | Recombinant Full Length Human CHRNA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *