Recombinant Tetronarce Californica CHRNA1 Protein (25-234 aa), His-sumostar-tagged
Cat.No. : | CHRNA1-2696T |
Product Overview : | Recombinant Tetronarce Californica (Pacific electric ray) (Torpedo californica) CHRNA1 Protein (25-234 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Tetronarce Californica |
Source : | Yeast |
Tag : | His&SUMO |
Protein Length : | 25-234 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.9 kDa |
AA Sequence : | SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | CHRNA1; |
UniProt ID | P02710 |
◆ Recombinant Proteins | ||
CHRNA1-406M | Recombinant Mouse CHRNA1 Protein (21-230 aa), His-SUMO-tagged | +Inquiry |
CHRNA1-534H | Recombinant Human CHRNA1 protein, His-tagged | +Inquiry |
CHRNA1-6379C | Recombinant Chicken CHRNA1 | +Inquiry |
Chrna1-778R | Recombinant Rat Chrna1 Protein, His-tagged | +Inquiry |
CHRNA1-1515T | Recombinant Torpedo californica CHRNA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *