Recombinant Tetronarce Californica CHRNA1 Protein (25-234 aa), His-sumostar-tagged

• Cat.No.: CHRNA1-2696T
• Product Overview: Recombinant Tetronarce Californica (Pacific electric ray) (Torpedo californica) CHRNA1 Protein (25-234 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Tetronarce Californica
• Source: Yeast
• Tag: His&SUMO
• Protein Length: 25-234 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 37.9 kDa
• AA Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: CHRNA1
• UniProt ID: P02710